KEGG   Cyprinodon variegatus (sheepshead minnow): 107091379
Entry
107091379         CDS       T06110                                 

Gene name
tm7sf2
Definition
(RefSeq) delta(14)-sterol reductase isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg00100  Steroid biosynthesis
cvg01100  Metabolic pathways
Module
cvg_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    107091379 (tm7sf2)
Enzymes [BR:cvg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     107091379 (tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 107091379
NCBI-ProteinID: XP_015240731
Ensembl: ENSCVAG00000018398
UniProt: A0A3Q2DA06
Position
Unknown
AA seq 430 aa
MKGTKMGRNKQAVNHRPTHDTEREFGGTLGAVCIPVFLPLTVLFLIGVSQSPEASVFQWP
PKLPSTDQLWDPLAPMLLLGWIGLHALLYFMPFGKVSEGLALRDGTRLKYPINGFHSLCV
SAVLLMVLLGLRAPLGFLFELLVPLAVSAIAVSFLFSIYLYVRSFLVPSHALALGGDTGN
PLYDFFIGRELNPRIGNFDLKYFCELRPGLIGWVVINLGMLMKEVELRGSPSLSMILVNC
FQLLYVADALWNEEAVLTTMDIVHDGFGFMLVFGDLAWVPFTYSLQASFLVVHPQTLSLL
KAAVIVALNGVGYYIFRKSNSQKNQFRRDPTHPSVSGLETIATATGKRLLVSGWWGLVRH
PNYLGDLLMALAWSLPCGFSHLLPYFYVIYFTILLIHREARDERQCKAKYGLAWDTYCRR
VPYRIFPYIY
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgaaggggacaaaaatgggacggaacaagcaggcggtaaatcacagaccaacccatgac
acagaaagagagtttggaggaactttgggtgctgtttgtattccagtttttctcccactt
actgtgctcttcctgattggtgtaagccaatcccctgaggccagtgtattccaatggccc
ccaaagctcccctccactgaccagctgtgggacccgctggctccaatgcttctgcttgga
tggatcggactgcatgcccttctctatttcatgccgtttgggaaggtctctgaaggattg
gctctgagggatggaacgcgtcttaaatatcccataaatggttttcacagtctgtgcgtc
agcgccgtgctgctgatggtgttgctggggctcagggctcctcttggatttctctttgag
cttctcgtgcctctggcggtgtctgcaatagccgtgtcgttcctgttctccatctacctc
tacgtccgctcatttttggttccctctcatgctctagccctggggggagacacaggaaat
cctctttatgacttcttcattggacgggagctgaacccacggattggaaactttgatctc
aaatatttctgtgaactcaggcctggtctgattggttgggtggtcataaacctgggaatg
ctgatgaaagaggtggaactccgaggctctccctccctctccatgatcctggtgaactgc
ttccagctgctttatgtggcagatgctttatggaatgaggaggctgttctgaccaccatg
gatatcgtgcatgatggatttgggttcatgctagtgtttggtgacctggcctgggttccc
ttcacctacagcctgcaggcttccttcctggttgttcaccctcagaccctttctttgctc
aaagctgcagttatagtagcactgaatggtgttggatattacattttcagaaaatccaac
tcgcagaagaaccagttcagacgagacccaactcacccaagcgtctcaggactggagacc
atcgccacagcaacagggaaacggctgctggtgtcaggctggtggggtctcgttcgtcat
cccaattacctcggtgacctccttatggcgctggcgtggtccctgccatgtggtttctct
catctcttgccttacttctatgtgatttacttcaccattctgctgattcaccgggaggcc
cgggatgagagacagtgcaaagccaagtacggcctcgcgtgggacacctactgtcgccgg
gttccctacaggatcttcccgtacatatactga

DBGET integrated database retrieval system