KEGG   Cyprinodon variegatus (sheepshead minnow): 107092012Help
Entry
107092012         CDS       T06110                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 4-like
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04020  Calcium signaling pathway
cvg04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107092012
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107092012
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cvg04030]
    107092012
G protein-coupled receptors [BR:cvg04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    107092012
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 107092012
NCBI-ProteinID: XP_015241763
Position
Unknown
AA seq 434 aa AA seqDB search
MATASPHHLLDEIINNGNQQQEQQEFLSSLETIFLTLFLSIIIIMTVFGNLLVMVALCKD
RHLRKKKTNYFIVSLAFADLLVALVVMPFAAIELTTGQWFFGEIFCLVRTSLDVLLTTAS
ILHLCCIALDRYYAICCQPLVYRHKMTPVRVAVMLSGCWLIPTLISFLPIMQSWNAIGIE
DIIEERRTLTGGSNDTSCVFLVNRPYALICSAVAFYVPLALMVLAYQRIYVTAMIHVRQI
ETLQRAGSAPVTGSDPVVTVRCSTSSDPLDHYCLRTATVSSPSEQTHGGHNRMRIETKAA
KTLAVIMGCFCLCWAPFFITNVVDPFIHYSVPWQLWTAWLWLGYINSGLNPFLYAFLNRA
FRRAFLVILCCGDQRYSRQGSFSRGHIHRPCSAPSVNGTSMALRLSFLPNRSYSDNGRTI
LANEQESQDSLGPL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggccacagcatcacctcaccatttgttggatgaaataataaataatgggaaccaacag
caggagcagcaggaattcttgagctctttggagacaattttccttaccctcttcctatct
atcatcattattatgactgtgtttggcaacctgttagttatggtggcactctgcaaggac
aggcatctgagaaaaaaaaagaccaactatttcattgtctctctggcgttcgctgaccta
ctggttgcactggttgtaatgccttttgctgccatcgagctcaccaccggccagtggttc
tttggggaaatcttctgcctggtgcgaacctctctggatgttttattgaccacagcatcc
atcctacacctctgctgcattgcactggacagatactatgccatctgctgccagccactg
gtctacagacataaaatgaccccggtgagagtggcagttatgctcagcggctgctggctc
atccccacattaatctcctttctacccatcatgcaaagctggaacgctattgggatagaa
gacattattgaagagaggcgaactctaacaggaggttccaatgacacaagctgcgtgttt
ctggtcaaccggccttacgccctcatctgctccgccgtggctttctatgtgcctctggcc
ctgatggttctggcctatcagcgcatctatgtcaccgccatgatccatgtcaggcagata
gagactcttcagcgtgccggatctgcaccagttacaggctcagatccagtcgtaactgta
cgctgttccacttcctcagatccactggaccattactgcctgaggacagcaactgtgtcc
tctccctcagaacaaactcatggagggcataaccgcatgcgcatcgagacaaaggcagca
aagactctggctgttataatgggctgcttctgcctttgctgggctccgtttttcattaca
aacgtggtggaccccttcattcattactctgttccctggcagctgtggactgcctggctg
tggcttggttatattaactcaggattgaaccccttcctgtatgccttcctgaaccgagct
tttcggagggcgttcctagtgattctctgctgtggagaccaacgttattctcggcagggg
agcttctcccgtggacacatccacaggccatgttctgccccgtcagtaaacgggacctcc
atggctctaagattgtccttcctaccaaaccgcagctacagcgataacggccggacaatc
ctggccaatgaacaggagtcacaagactctcttgggcccctatga

DBGET integrated database retrieval system