KEGG   Cyprinodon variegatus (sheepshead minnow): 107093354
Entry
107093354         CDS       T06110                                 

Gene name
dck
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg00230  Purine metabolism
cvg00240  Pyrimidine metabolism
cvg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107093354 (dck)
   00240 Pyrimidine metabolism
    107093354 (dck)
Enzymes [BR:cvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     107093354 (dck)
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_28 Thymidylate_kin AAA_17
Other DBs
NCBI-GeneID: 107093354
NCBI-ProteinID: XP_015243846
Ensembl: ENSCVAG00000001008
UniProt: A0A3Q2DL28
Position
Unknown
AA seq 263 aa
MPSIPKRPCPDAMNDSMEKRIKRISIEGNIAAGKSTFVRLLEQESNDWEVVPEPIARWCN
VQTSTSDFEELTTSQRSGGNVLKMMYEKPERWAYTFQSYACISRVRAQARSANGKLREAE
NPVLFFERSIYSDRYIFAGNLYESECMNETEWSIYQDLHGWLHNQFGKHIELDGIIYLRA
SPERCLERLHTRGREEEQEIPLEYLEKLHFKHESWLQNKTMSMEFEYLNDVPVLTLDVND
DFKQNDSKSGDMIEKVKEFLSTL
NT seq 792 nt   +upstreamnt  +downstreamnt
atgccttccataccgaagagaccctgccccgacgccatgaatgactccatggagaaaaga
ataaagcgcatttctatcgaaggaaacattgcggcggggaagtctacttttgtgcgcctt
ttggagcaggagagcaatgactgggaggtagtaccagaaccgatcgctagatggtgcaac
gtccaaacatcaaccagcgactttgaggagctgaccacctctcagaggagcggcggaaac
gtgttgaagatgatgtatgaaaagccggagaggtgggcatacaccttccagagctacgcc
tgcatcagcagggtgcgtgcccaggccagatcagccaacggcaagctccgagaggccgag
aaccctgtgttgttctttgaacgatccatctacagtgacaggtacatatttgcaggcaac
ctatatgagagcgaatgcatgaatgagacggaatggtccatctatcaggacttgcatggc
tggctgcacaaccagtttggcaagcacatcgagctcgatggcatcatttacctcagagct
tctccagagagatgcttggagcgactgcacactagaggaagagaggaggaacaggaaatc
cccctggaatacctggagaagctccacttcaagcatgagagctggttgcagaataagact
atgagcatggagtttgagtacctcaatgatgtgcctgtactgaccttggatgtaaacgat
gattttaagcagaacgattccaagagtggcgacatgattgagaaggtgaaggagttcttg
agcacgttgtga

DBGET integrated database retrieval system