KEGG   Cyprinodon variegatus (sheepshead minnow): 107093538Help
Entry
107093538         CDS       T06110                                 

Gene name
cacng3
Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04010  MAPK signaling pathway
cvg04260  Cardiac muscle contraction
cvg04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107093538 (cacng3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107093538 (cacng3)
   04261 Adrenergic signaling in cardiomyocytes
    107093538 (cacng3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cvg04040]
    107093538 (cacng3)
Ion channels [BR:cvg04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107093538 (cacng3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 107093538
NCBI-ProteinID: XP_015244151
Ensembl: ENSCVAG00000022246
UniProt: A0A3Q2DHW3
Position
Unknown
AA seq 317 aa AA seqDB search
MKMLMCDRGVQMLVTTVGAFAAFSLMTIAVGTDYWLYSRGVCRVKSSGDNDTSRKNEEVM
THSGLWRTCCLEGTFRGVCKKIDHFPEDADYEADAAEYLLRAVRASSIFPIMSVGLLFLG
GLCVAASEFYRSRHNVILSAGIFFVSAGLSNIIGIIVYISANSGDPGQSDSKKSYSYGWS
FYFGALSFIMAEMVGVLAVHMFIEKHRKLRAKSRTELIKKSAFSRIPSYRYRFRRRSSMR
SSEAPSRDTSPLGKGGYTGPAASEMPMYTLNPREVGNAGSKPGGGMGGLLNSEREFLQSS
TLTKDYNKDPNRRTTPV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgctgatgtgtgaccgcggcgtccagatgctcgtgacgacggtgggcgcgttc
gccgccttcagcctcatgaccatcgccgtcggcacggactactggctgtactcgcgcggg
gtttgccgcgtgaagagcagcggcgacaacgacacgagccgcaagaacgaggaggtgatg
acgcactccggcctctggcgaacctgctgtctggaagggacattcagaggtgtatgtaag
aagattgatcactttccagaggatgctgactatgaagcggatgctgctgaatacctccta
cgtgccgtcagagcctccagtatcttccccatcatgagtgttggtctgttgtttctgggg
gggctctgtgtggctgccagtgagttttaccggagccgacacaatgtcatcctcagtgca
ggaatcttcttcgtatctgcaggactcagtaacatcattggaattattgtttacatctca
gccaattctggagaccccggtcaaagcgacagcaagaagtcctactcgtatggctggtcc
ttctacttcggcgccttgtccttcatcatggctgaaatggtaggcgtgttagcggtgcac
atgtttatcgagaagcaccgtaagctgcgcgccaagtcccgcactgagctcataaagaag
tccgcattcagccgcattccttcctaccgttaccgattccggcgccgctcaagcatgcgt
tcctccgaggctcccagccgagacacatcaccgctggggaagggtggctacactgggccg
gctgcctcagagatgcccatgtacacgctgaacccaagagaagtgggtaatgcaggcagc
aaaccaggtggcggcatgggtgggctgctcaactcagagagggagttcctccagagcagc
acgctaactaaagactacaacaaggaccccaaccgcaggaccacgccagtctga

DBGET integrated database retrieval system