KEGG   Cyprinodon variegatus (sheepshead minnow): 107093577Help
Entry
107093577         CDS       T06110                                 

Definition
(RefSeq) autophagy-related protein 16-1-like
  KO
K17890  autophagy-related protein 16-1
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04136  Autophagy - other
cvg04140  Autophagy - animal
cvg04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107093577
   04136 Autophagy - other
    107093577
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107093577
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cvg04131]
    107093577
   03029 Mitochondrial biogenesis [BR:cvg03029]
    107093577
Membrane trafficking [BR:cvg04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    107093577
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    107093577
Mitochondrial biogenesis [BR:cvg03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    107093577
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 UPF0242 OAF SYCE1 DUF2570 CemA
Motif
Other DBs
NCBI-GeneID: 107093577
NCBI-ProteinID: XP_015244204
Position
Unknown
AA seq 254 aa AA seqDB search
MESWKNHVRDRLFHRDDKEKLPFVGVFTKLSQLEEKLEIRKQILEDIQGKSLDIAVESGI
NGKLFQLQLRESEHLADKLSQTVSDMTSVLYVKEAELQYWRSRVSQYHQEALNLAKAKKY
LKATLIELEFTVECQSKELTALRWEQTQLKEALEQAQRDNEQLVQRWMEEKSAEAERLNK
HNDISEKWQHLSKRLKKHFRQERESQFTPLFTETMDGAKGTSLSVNQRVCNATEDVQIKT
ASLRQKKSGIALGS
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggagagctggaagaatcacgtgagagatcgactttttcacagagacgataaagaaaaa
cttccatttgttggcgttttcactaaattgtctcaattggaggaaaaacttgaaatacgc
aaacagattttggaggatattcaggggaaaagtttggatatagcagtggaatctggaata
aatggcaaactctttcaacttcagctgagagaaagtgaacacctggcagacaagctatct
caaactgtctctgacatgacctcagtcttgtatgtgaaagaagctgagctacaatactgg
cgctcacgtgtgtcccagtaccaccaagaggcactcaatctggctaaagcgaaaaaatat
ttaaaggcaacccttatagagttggagttcaccgtggagtgtcagtccaaagagctgaca
gccctgagatgggagcagacccaactaaaggaggctttggagcaggctcagagagacaac
gagcaacttgtgcagcgatggatggaggaaaagagtgcagaagcagaacgacttaataaa
cacaacgacatatcagaaaagtggcaacatctgagcaaacggctgaagaagcatttccgc
caggaaagggaatcacagtttactcccttatttacagagactatggatggtgcaaaagga
acgtctctgtcagtcaatcagagagtctgtaacgctacagaggatgttcagataaaaaca
gcttcgctgcgtcagaaaaagtctggtatcgccctgggatcttaa

DBGET integrated database retrieval system