KEGG   Cyprinodon variegatus (sheepshead minnow): 107093728
Entry
107093728         CDS       T06110                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04080  Neuroactive ligand-receptor interaction
cvg04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107093728 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107093728 (apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 107093728
NCBI-ProteinID: XP_015244433
Position
Unknown
AA seq 75 aa
MNVKILTLVIVLLVSLLCSAGAGPMASTEHGRGLEGANTVRKMAQQTPVRGGQTHRPSKR
RRPRPRLSHKGPMPF
NT seq 228 nt   +upstreamnt  +downstreamnt
atgaatgtgaagatcctgacgctggtgattgtgctcttggtgtctctgctgtgttctgcc
ggtgctggtcccatggcctccacggagcatggcagagggctggaaggggcaaatacagtg
agaaaaatggcccagcaaactccagtaagaggaggtcagacccacagaccaagcaagaga
agacgcccacggccccgcctttcccacaaggggcccatgccattctag

DBGET integrated database retrieval system