KEGG   Cyprinodon variegatus (sheepshead minnow): 107093944Help
Entry
107093944         CDS       T06110                                 

Gene name
gucy1a2
Definition
(RefSeq) guanylate cyclase soluble subunit alpha-2
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg00230  Purine metabolism
cvg01100  Metabolic pathways
cvg04270  Vascular smooth muscle contraction
cvg04540  Gap junction
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107093944 (gucy1a2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107093944 (gucy1a2)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107093944 (gucy1a2)
Enzymes [BR:cvg01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107093944 (gucy1a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB Rx_N DUF4761
Motif
Other DBs
NCBI-GeneID: 107093944
NCBI-ProteinID: XP_015244789
Ensembl: ENSCVAG00000006919
UniProt: A0A3Q2FL13
Position
Unknown
AA seq 808 aa AA seqDB search
MSSSSRKISSESFSSSVGSDCGLESPGGDGGDGALEPADESRGCPFSSFPSAHRAVLWNG
RSPAERPACPAREEQQQGPCGPHKRATRRRRVNLDSLGESLKRLTSPTTQTVQEALHRTL
QFYRKQEIRCQNEEGGERQHEKKEEKCLFLENSGSEEDVLQILQYMATILGVPFCELREH
FGEEFFGLCFEENERVLRAVGGNLQDFFNGFDAILEHIRTSTGRRASSESPSFQCKDPRE
EEKDRGKLEKLGNRGSRDSRGKVLFLHCFNPAPVVGLVMPGLIRAVARRIFHSEVEVEEV
PPLTPLLPNEDAEQTDCDSTTPTPTASPTASPPSSPSPPSLFPTSVPTVCLSFLIQETCT
SPLSSIPNSASVSTNRPPLHLSTNPSDLRISLATFCRAFPFHLVLGHRMELLQLGEGLRK
QARIEPHRILSFRDCFEIVSPKMEPSFQGILLRLASPFTIRTRPDPMQAGTKEKVMELKG
QMIHVPESCSLMFLGSPRVDKLEELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKR
MDKLKATLERTHQALEEEKRRTVDLLYSIFPGDVAQKLWQGQPVPARKFNDVTMLFSDIV
GFTAVCAHCTPMQVISMLNELYTRFDYQCGILDVYKIETIGDAYCVAGGLHKKVDSHAKP
IAQMALKMMELSEEVLTPDGKPIKLRIGIHTGSVLAGVVGVKMPRYCLFGNNVTLASKFE
SGSHPRCINVSPTTYQLLKDDRSFSFIPRSRLELPDNFPKEIPGTCYFLEAGTSHSHASL
TSSRSAPPASMRKVSYSIGTMFLRETSL
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgtcgtcgcgcaagatttcctccgagtcatttagcagctcggtgggctcagac
tgtgggctggagagccccggaggagacggaggggacggcgctttggagccggctgatgag
agccggggctgcccgttctcctccttcccttcggcccacagagcggtgctgtggaacggc
cgcagccccgctgagaggccggcgtgcccggcgagagaggagcagcagcagggaccctgc
gggccccacaagagggccaccaggcggcgaagggtcaacctggactcgttgggggaaagc
ctgaaaagactcacttcacccacgacacagactgttcaggaggctctacatcgaactctg
cagttttacagaaaacaagagatcaggtgtcagaatgaagaaggtggggaaaggcagcat
gagaaaaaggaggagaagtgcctgtttcttgaaaactctggttcagaagaagatgtccta
cagattcttcagtatatggccacaatattaggagtgccattctgtgagctgcgagagcat
tttggagaggagttctttggtctctgcttcgaagagaacgagcgagtgctgcgggctgta
ggtggcaaccttcaggatttcttcaatggttttgacgccattttagaacacattcgcacc
tccacggggcgccgagcctcctccgagagcccttcctttcagtgcaaggacccccgcgaa
gaggagaaagatagagggaaattggagaagcttggaaatcgtggcagcagagacagcaga
gggaaggtgctgtttcttcactgtttcaaccctgcacctgttgtgggattagttatgcca
ggtttgattagagctgtcgccaggcgaatctttcattcagaggttgaagtggaagaggtg
ccacctctaactcccctgctgccaaatgaagatgctgaacaaacagactgtgattctaca
acccccactcccacagcgtcccccactgcttcacccccctcatccccgtcccctccatcc
ctttttccaacttcagtccccacagtttgtctatccttcttaatccaagagacttgcact
tctccgctctcttccatcccaaattcggcatctgtcagcactaaccgccccccacttcac
ctatctactaatcccagcgatcttcgcatttccctggctacgttctgccgtgccttccct
tttcacctagtcctggggcatcgcatggagctgctgcagcttggagaaggactgaggaaa
caggctcgcattgagcctcacaggattctctcattcagggactgttttgagattgtctca
cccaagatggaaccctctttccagggcatactgctgagacttgcttcgccatttactatc
cgtaccaggcccgaccccatgcaagctggcactaaggagaaggttatggagctaaagggt
cagatgattcatgtccctgagtcctgttccttgatgtttctgggttctccgcgtgttgat
aagctagaggagctgatgggcaggggtctccatctgtcagacattcccatccatgatgcc
actcgagatgttatcctggtaggagagcaagccaaggcccaggatggcctaaagaaaaga
atggacaaattaaaggctaccttagagaggactcatcaagctctggaggaagaaaaaagg
aggacagtggatctcctctattccatatttccgggtgatgtggcgcagaagctgtggcag
ggtcagccagtgccagcgcgtaaatttaatgatgtcaccatgcttttctccgacatcgtg
ggctttactgctgtgtgtgcccactgcacacctatgcaggttatctcaatgctgaacgag
ctctacactcgctttgactaccagtgtggcattctggatgtttataagattgaaacaatc
ggggatgcctactgtgtggcaggcggacttcataagaaggttgatagccatgcaaaacca
attgcacaaatggctcttaaaatgatggagctttctgaggaagtactgacgcctgatggg
aaacctatcaagctaagaataggcatccacaccggctcagtactggcaggcgtagtcggg
gttaaaatgccacgatattgcctgtttgggaacaacgtgactctagccagcaagtttgaa
tcaggaagccatccaaggtgcatcaatgttagtccaaccacctaccaattgttgaaagac
gaccgttctttttcattcatccctcgctctcggctggagctcccggacaattttcccaaa
gagattccagggacatgttacttcctggaggcagggacttcccacagccatgcctcactt
accagctctcgctcggctcctccggcctctatgaggaaggtctcctacagcatcgggaca
atgtttctaagagagaccagtttgtag

DBGET integrated database retrieval system