KEGG   Cyprinodon variegatus (sheepshead minnow): 107094210
Entry
107094210         CDS       T06110                                 

Gene name
mecom
Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1 isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107094210 (mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cvg03000]
    107094210 (mecom)
Transcription factors [BR:cvg03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    107094210 (mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-C2H2_8 zf-BED PyrI_C
Other DBs
NCBI-GeneID: 107094210
NCBI-ProteinID: XP_015245186
Ensembl: ENSCVAG00000018979
Position
Unknown
AA seq 1258 aa
MRSKGRARKLATSDGDDDFAVYSSSVLDDVCDSNGDPSHSTAQADDPLSDDDSSSPSLQQ
AGILFPQSNLSVPLDFELRESTVPGASLGIWSRRKVNVGESFGPYEGEHTPCLQDPTQGW
EILDGSGHVKFCVDASKPDAGSWLKHIQFAPAATPHNLRACQIGDQIFYKVTREIFPGEE
LLLFMKAEDYFCNTMAPDIHEERQYRCEDCDQHFESRNQLLDHQKEPCGMPPSAFLNPGE
EGDLTAQEPQDLRPLHMSHGLHECKECDQVFPDVQSLENHSQSHSEEREYKCDQCPKAFN
WKSNLIRHQMSHDSGKHYECENCSKQVFTDPSNLQRHIRSQHVGARAHACSDCGKTFATS
SGLKQHKHIHSSVKPFMCKSLRPYLCEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQ
MFSTTSSLNKHRRFCEGKNHFTAGGLFAQGLPLPGTPGLDKSALTLGHSSAGLADYFGAS
RHHSGLTFPAAPAFPFSFPGLFPSGLYHRPPLIPATSSPVRQTAHAPVSGPGAELSKSPL
LPPSPGAIESQELLKALRKNGSSPGNDLQDSELHNQGSLVSSKQQNKQSDQSESSDVDDV
STPSGSDLESTTGSELESDMDSERERGAARENGKGSRRKASDRGPQSPSLIGSSTAKDLP
GQTLIQSSLDEHTAVTGAVNDSIKAIASIAEKYFGSAGLAGLQDKKVGSLPYPSMFPLPF
FPAFSPPVYPLPDRDLRPTSVKGEPQSPGDDCKKAQSKSSESPFDLTTKRKEGKLPLFVP
SKSEVSNVTSQDQPLDLSLGSRGRGRIPSQEEAKKNKSYEEEKRAVEVPKADASLQHARP
TPVFMDPIYSRVEKRRMSDPFETLKDKYMRPTPGFLFHPQFRLPDQRTWMTAIESMAEKL
ETFGSLKQESGELLRSVPSMFDFRAPPSTLPETLLRKGKERYTCRYCGKIFPRSANLTRH
LRTHTGEQPYRCKYCDRSFSISSNLQRHIRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKK
HENGHLSGTAMSSPQSELDSGSAILDDKEDSYFNEIRNFISSTNQNQTSPDPSEEGLNGG
LLEEGKSLMPSHGPRDLEDEEAEDLDAEEDEAEEPINTPEKRDVKVHPGSLGDDEMDFNE
SNELNLSSKTSPRRFTHEEEQNSLSALEHIHRFSDLHKMEESEPSDGDEEDGSFGSPSLA
DAVKQPLFRKSKSQAYAMMLSLAEKDSLHSTPHTPATMWHSLARAAAESSAIQSLSHV
NT seq 3777 nt   +upstreamnt  +downstreamnt
atgaggtccaaaggcagggcgcggaaactggccacgagtgatggcgatgatgactttgca
gtctattcaagcagcgtcttagacgacgtttgtgactcaaatggcgatccttcacattct
acggcccaggcagatgacccgctgtccgacgatgactcttcatctccatcactccaacaa
gcaggcattcttttccctcaaagcaacttaagcgttcctctggactttgaattgagagag
tcaacggttccaggtgcgagtctgggcatctggagccgcaggaaggtgaatgtaggggaa
agctttggaccatatgagggagagcacacgccctgtctccaagatcccacgcagggttgg
gagatcttggacgggtcaggccatgtaaagttctgcgtcgatgccagcaagccagatgca
gggagctggctgaagcacatccagtttgcccctgcagccacgccacataacctgagagcg
tgccagataggtgatcagatcttctacaaagtcactagagagatttttcctggcgaggag
ctgttacttttcatgaaggctgaagattatttctgcaacacgatggctcctgatattcac
gaggagaggcagtatcgctgtgaggactgcgaccagcactttgagtctcgcaaccagctg
ctggatcaccagaaggagccatgcgggatgcccccctctgccttcctcaacccaggagaa
gaaggtgacctgacggctcaagaacctcaagatttgcggccccttcatatgtctcatggc
ctgcatgagtgtaaggagtgtgaccaggtctttcctgatgtccaaagtctggagaatcac
agccagtctcactctgaggaaagagaatacaagtgtgatcagtgtcccaaggctttcaac
tggaaatcaaacttgattcgacatcagatgtctcatgacagtggcaagcattacgaatgt
gagaactgctcaaagcaggtgttcacagaccccagtaacctgcagaggcacattcgttct
cagcacgtcggggctcgggcccatgcctgttctgactgcggcaagacgtttgcaacgtct
tcaggcctcaagcagcataagcacattcacagcagtgtcaagcccttcatgtgtaagtca
ctaagaccctacctatgtgaggtatgccacaagtcctatacccagttttctaacctttgt
cggcacaaacgcatgcatgctgactgtcgcacgcaaatcaaatgcaaggactgcgggcaa
atgttcagcaccacctcatccctcaacaagcatcggcgcttctgtgaaggaaagaatcat
tttacagcaggggggttgtttgcccagggattgccactccctggcacccctggcttagac
aaatcagctcttacactcggccacagcagtgctggacttgctgattactttggagcaagc
cgccaccacagcgggctcaccttcccagcagccccagcatttcctttcagcttccctggc
ctgtttccttctggactatatcaccggcctccgctcattcctgccacttcctctcctgtc
agacagacagcccatgcacctgtttcagggcctggtgcagagctaagtaaaagtcctttg
cttcctccaagtcctggtgctattgagtctcaagagttgctgaaagctctgcgcaaaaat
ggcagttcacctggaaatgacttgcaagactcagaactccacaatcagggttctttggtg
tcttcaaagcagcagaacaagcaaagtgatcagtctgagagcagtgatgtggatgatgtt
agcacaccaagtggaagtgatctagagagcacaacaggctctgaacttgaaagcgacatg
gacagtgaacgggagaggggagctgctcgagaaaatggtaaaggttccaggagaaaggcc
agtgatagaggccctcaaagccccagcttgatcggtagcagtactgctaaagacttgcca
ggtcaaaccctcatacagtcttcgctagatgagcacacggctgtaacaggggctgtaaat
gactctattaaggccattgcttctattgctgagaagtattttggctcagctggactggct
ggcttgcaggacaagaaggttggatctctgccctacccctctatgtttccactgcctttc
ttcccagctttctctccaccagtttaccccttgccagacagggaccttagaccaacaagc
gtgaagggagagccacagtcgccaggagatgactgcaagaaggctcaaagcaagtcatct
gaatcaccgtttgacctcacaacgaagcgaaaggagggcaagttgcccctgtttgttccc
tccaaatctgaggtctcaaatgttactagtcaagaccagccactcgatctaagcctgggt
tccaggggtcgaggacgcattccaagtcaggaggaggctaaaaagaacaaaagctatgaa
gaggagaagagagcagttgaagttcctaaagcagacgcttctttacagcatgcccgtccc
accccggtttttatggacccgatatacagcagggttgagaagaggagaatgagtgatccg
tttgagactctgaaagacaagtacatgcggccaactccaggcttccttttccatccacaa
tttcgtttgccagatcagagaacttggatgacggccattgagagcatggcagagaagctg
gagacatttggttccttgaagcaagagtctggagaactgctgcgttctgtcccgtcaatg
ttcgacttcagagctccaccgtccacacttccagaaacactactgcgcaagggcaaggag
cgctacacctgcagatactgtggaaaaatattccctcgctctgccaacctgactcgccac
ctcaggactcatacaggagagcaaccatacaggtgtaaatactgtgaccgctccttcagc
atctcctccaacctccaaaggcacattcgcaacattcacaacaaggagaaacccttcaag
tgccacttgtgtgaccgctgctttggccagcagaccaacctagaccgccacctcaaaaaa
catgaaaatgggcatttgtcaggaactgcgatgtcgtccccacagtctgagttggacagc
ggcagtgccatacttgatgacaaagaggattcgtattttaatgaaataagaaatttcatt
agcagcacaaatcagaatcagacatcaccggacccctctgaggaagggctaaatggaggc
ctcctagaggaggggaaatcgctaatgcccagccatgggccacgtgacctggaggatgaa
gaagcagaagatttggatgctgaggaggatgaagcagaggagccgattaacactcctgag
aaaagggacgtcaaggtgcatcctggcagccttggagatgatgaaatggattttaatgag
tccaacgaactaaacctcagctctaaaacctctccaaggaggtttacgcatgaggaagag
cagaacagcttatcagctttggaacacattcatcgtttctctgacctgcataaaatggag
gagagtgaacctagtgatggagatgaggaagatggatcctttggttctccttcacttgct
gatgcagtcaaacagccactctttaggaaatccaagtctcaggcgtatgccatgatgttg
tctctggctgaaaaggactctctccactccaccccccacactccggccaccatgtggcac
agtctggcaagggctgctgctgaatccagtgccatccagtcacttagccacgtatga

DBGET integrated database retrieval system