KEGG   Cyprinodon variegatus (sheepshead minnow): 107097705Help
Entry
107097705         CDS       T06110                                 

Gene name
gucy1b3
Definition
(RefSeq) guanylate cyclase soluble subunit beta-1
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg00230  Purine metabolism
cvg01100  Metabolic pathways
cvg04270  Vascular smooth muscle contraction
cvg04540  Gap junction
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107097705 (gucy1b3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107097705 (gucy1b3)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107097705 (gucy1b3)
Enzymes [BR:cvg01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107097705 (gucy1b3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Motif
Other DBs
NCBI-GeneID: 107097705
NCBI-ProteinID: XP_015250447
Ensembl: ENSCVAG00000011420
UniProt: A0A3Q2CUP1
Position
Unknown
AA seq 619 aa AA seqDB search
MYGFVNHALELLVLRNYGPEVWEDIKREAQLDIEGQFLVRIIYEDAKTYDLVAAASKVLK
VDAGEILQMFGKMFFEFCQESGYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSF
RCTDAEKGNNLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIEMKVIQPKSEECDHIKFL
IEEKDSEEEAFYEDLDGFEENGTQETRISPYTFCKAFPFHLMFDKDLMLTQCGNAIYRVL
PQLQPGACILPSVFSLVRPHIDFSFHGILSHINTVFVLRSKEGLLNVETVENEDELTGVE
ISCLRLKGQMIYLPEAENILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFR
EEYKLTQELEILTDRLQHTLRALEDEKKKTDRLLYSVLPPSVANELRHKRPVPAKRYDNV
TILFSGIVGFNAFCSKHASAEGAIKIVNLLNDVYTRFDILTDSRKNPYVYKVETVGDKYM
TVSGLPEPCTHHAKSICHLALDMMEIAGQVKVDDEPVQITIGIHTGEVVTGVIGQRMPRY
CLFGNTVNLTSRTETTGEKGKINVSEYTYRCLQSAENADPQFDLEYRGPITMKGKKEPMK
VWFLSRKTNDTAESAVVKL
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgtacgggtttgtgaatcacgccctggagctcctggttttaaggaattacggcccagaa
gtgtgggaagacataaagagggaggctcagctcgacattgagggtcagttccttgttcga
atcatatacgaagatgctaaaacctacgatcttgttgcggctgcaagtaaagttctgaag
gtcgatgcaggagaaatcttgcagatgtttgggaagatgttttttgagttttgccaggag
tcgggctatgacaccatattacgtgtgctgggctcaaatgtccgggagttcctgcagaac
ctggatgccctacacgaccacctgggtaccatttaccccgggatgagggcgccatcgttt
cgctgcaccgacgctgagaagggaaacaacctgatcctccactactactctgagagagaa
gggttgcaggatattgtgattggcatcattaaaacagtcgctcaacaaatccacggcaca
gagatagagatgaaggtgatccaacccaagagcgaggagtgtgatcacatcaagtttctg
attgaggagaaggactcagaagaggaggcgttctatgaagatctcgacggttttgaggag
aacggcacgcaggagactcgaatcagcccgtacaccttctgcaaggctttccccttccac
cttatgtttgataaagacctgatgctcacacaatgtggaaacgccatctacagggtgctg
ccacagctccagcctggtgcctgtatccttccatccgttttttccttggttcgtccccac
atcgacttcagttttcatggcatcctgtcccacatcaacactgtctttgttcttcggagc
aaggagggcctgcttaatgtggagaccgtggagaatgaggatgagctgacaggggtggag
atcagctgtctgagactgaaagggcagatgatttatttgcctgaggcagagaacatcctt
ttcctttgctcgcccagtgttatgaacctggatgatctgacgaggagggggctctacctc
agtgacatcccgctgcatgatgccacgcgtgacctggtgctgctaggggaacagtttcgt
gaggagtacaagctgacccaggagctggaaattttgacagatcgtcttcagcacacactg
agggccctggaggatgaaaagaagaagacagacagactgctctactctgttctgccaccg
tctgttgccaacgagctgcgccacaagcgcccggtcccagccaagcgttacgacaacgtc
accatcctgttcagcggcatcgttgggttcaacgctttctgcagcaagcacgcctcggcc
gagggagccatcaagatagtcaacctgctcaatgatgtttacacgcgcttcgacatcttg
acagactctcggaagaacccttatgtatacaaggtggaaacagtgggtgataagtacatg
acagtgagcggtttgccggagccttgcacgcaccatgccaagtcaatatgtcacctcgcc
ctcgatatgatggagattgcgggacaagtcaaagtggacgatgaaccagtacagattacc
atcgggatccatactggagaggtagttacaggtgtgattggccaacggatgcccagatat
tgcctttttggaaatacggttaacctcacaagtcgaactgagacgacgggcgaaaagggg
aaaattaacgtctcagaatacacttacaggtgtttgcagtccgctgagaacgccgacccc
cagtttgatctggagtaccgcggcccgatcaccatgaaaggaaagaaggagcccatgaag
gtgtggtttctttctaggaagaccaatgacacagcagagtctgctgtggttaaactttaa

DBGET integrated database retrieval system