KEGG   Cyprinodon variegatus (sheepshead minnow): 107097921Help
Entry
107097921         CDS       T06110                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cvg04131]
    107097921
Membrane trafficking [BR:cvg04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    107097921
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2
Motif
Other DBs
NCBI-GeneID: 107097921
NCBI-ProteinID: XP_015250760
Position
Unknown
AA seq 1530 aa AA seqDB search
MFVIYDCRSPDFHDEIKIKLPASLSDHHHILFTFYHVSCQQKQNTPLETPVGYTWIPMLQ
NGRLRTGHFCLPVSLEKPPQSYSVLSPDVPLPGMKWVDNHRGVFNVELVAVSTIHTQDQY
LDKFFALVHALDEHVFPVRIGDMRIMENNLETELKSSIAALNSAQLEPVVRFLHLLLDKL
VLLVVRPPVIAGQIVNLGQASFEVMASVVNRLHKYLDTSQDMHGRNSLLSSYIHYVFRLP
STDPNSPSPGPGGLGGSVHYATMARSAVRPASLNLSRSRSLSNSNPDISGTPTSPDDEVR
SIIGSKGLDRSNSWVHTMGCSAPWGSSPGSAPETMQAMERCGNRMSSHTESASFLQTLTG
RLPTKKLFHEELALQWVVSSGSVREGALQQAWFFFELMVKSIIHHLYFTERLESPRKNRF
PERFMDDITALVSTIAGDIVSRFQKDLELVERINTSLAFFLNDLLSVMDRGFVFTLIKTY
WKQVSTKLYALQNPTLESLRLDFLRIVCSHEHYVTLNLPCSLLTPPASPSPSVSSATSQS
SGFSTHVQDQKIANMFELSIPFREQHYLAGLVLSELSVLLDPDNEGMFGLHKKVVSVVHN
LLSSHDSDPRYADPEVKARVAMLYLPLIGIVMETLPQLHDFTESHNQWGRPGCPQGTAVG
SGGEETEGEGNSMISQTVAMAIAGTSTASPMSRPSSFLLNTQTGRQHGSFSAESSRSLLI
CLLWVLKNADELVLQKWFTDLSVSQLNRLLDLLYLCVSCFEYKGKKAFERMNSLTFKKSK
DMKAKLEEAILGSIGARQEMVRRSRGQLERSPSGSAFGSQENLRWRKDMTHWRQNSERMD
KSHRSVRTRAELEHEALIDGNLATEANLIILDTLEIIVQTASVTESKESILGGVLKVLLH
SMACNQSALYLQHCFATQRALVSKFPELLFEEETEQCADLCLRLLRSCSSSISTIRSHAS
ASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSQNFNEEFLRRSLKTILTYAEEDLEL
RETTFPDQVQDLVFNLHMILSDTVKMKEHQEDPEMLVDLMYRIAKGYQTSPDLRLTWLQN
MAGKHSERNNHAEAAQCLVHSAALVAEYLSMLEDRKYLPVGCVTFQNISSNVLEESAVSD
DVVSPDEEGICSGKYFTEIGLVGLLEQAAASFSMAGMYEAVNEVYKVLIPIHEANRDAKK
LATIHGKLQEAFSKIVHQSTGWEDGKRMFGTYFRVGFYGSKFGDLDEQEFVYKEPAITKL
AEISHRLENFYGERFGEEQVEVIKDSNPVDKCKLDPNKAFIQITYVEPYFDTYEMKDRIT
YFDKNYNLRRFVYCTPFTLDGRAHGDLHEQFKRKTILTTSHAFPYIKTRINIIHKEEIIS
TPIEVAIEDMQKKTQELAFATHQDPADAKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPI
DPKLYRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLIN
RKIPQLYKPVLQVNSHRDSFSRLSLRKLDI
NT seq 4593 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtcatatatgactgcagatcccctgacttccatgatgagataaagataaagttg
cctgcttcgctgtcagaccaccaccacattctcttcacgttttaccatgttagctgccag
cagaagcagaacacaccactagagacccctgtggggtacacgtggatcccaatgttacag
aatggtcgcctgagaacgggacacttttgcttgcctgtatcccttgagaaaccaccacag
tcatactcagttctctctccagatgtccctcttccaggaatgaagtgggtagacaaccat
cgaggtgtatttaatgtggagctggtggctgtttccactatccacacacaggaccagtac
ctggataagtttttcgccttggtgcatgccctggatgagcatgtgtttccggtcaggatt
ggagatatgcgcatcatggaaaacaatcttgagactgagctgaagtccagcatcgccgcg
ctaaactcggcacagctggagccggtggttcgattccttcaccttctacttgacaagttg
gtgttgctcgtagttcgaccgccagtcatcgctggacagattgtgaatctaggtcaggca
tcctttgaggtgatggcatctgttgtgaaccggcttcacaagtatctggacaccagccag
gacatgcacggtcgcaacagcttgctgtcctcttacatccactatgtcttccgcttaccc
agcactgatcccaactcaccatcaccaggtcctggggggttgggaggttcagttcactat
gccaccatggctcgctcggcggtcagaccagccagccttaacctcagtcgctcccgcagc
ctgagcaacagtaaccctgacatttccggtacgcccacatctcccgatgacgaggttcgc
tctataattggaagcaagggcttagaccgctccaactcgtgggtgcacaccatgggctgt
agtgccccctggggatccagccctgggtccgctccagaaaccatgcaggccatggagcgc
tgtggcaatcgcatgtcttcgcacactgagagcgccagtttcttgcaaactttaacagga
cggttacccactaaaaagctttttcacgaggaattggccctacagtgggtggtgagcagt
gggagtgttcgggagggagctctgcaacaggcctggtttttctttgagctaatggtaaag
agcattatccaccacctttacttcactgagcgcttggagtcaccaaggaaaaaccgattt
cctgagcgctttatggatgacattacagcgctggtcagcacgattgctggagacattgtt
tctcgtttccagaaggatctggagttggtggagaggattaacacaagtctggctttcttc
ctcaatgatctgctgtcagtcatggaccgaggctttgtcttcacattaatcaagacatat
tggaaacaggtttcgacaaagctttacgcattgcagaacccaactttggagtctttacgg
cttgattttctacgaatagtttgcagtcatgaacactacgtcaccctgaatctgccctgc
agtctgctaactccacctgcttcgccttctccatcagtatcctcagcaacctcacagagc
tctgggttttccactcacgtccaggaccaaaaaatagccaacatgtttgagctttccatc
ccattccgagagcagcattatcttgctgggcttgtgctgtctgagctgtctgtattactg
gacccagataatgaaggaatgtttggtctacataagaaggtggtaagcgttgttcacaac
ctcttgtcgagccatgactctgaccctcgttatgctgacccggaggtcaaggctcgggtc
gccatgctctacctgcctcttattgggattgttatggagaccctgccgcagcttcatgac
ttcacagaatcccataatcagtgggggcgtcccggatgtccccaaggtacagctgtgggt
agtggaggagaagagacagaaggagagggtaacagtatgattagtcagactgttgccatg
gcgatagctggtacctcaactgcatctccaatgtcccgaccaagtagctttttgctaaac
acgcagacgggtcgccagcatgggagcttctctgccgagtcgagtcgcagtctgctgatc
tgtctgctttgggttttgaagaacgctgatgagctggtgctgcagaaatggtttactgac
ctgtctgtgtctcagctcaaccgtctgctggatctcctctacctctgcgtgtcctgcttt
gaatataagggaaaaaaggcgtttgagcgcatgaacagcttgacttttaagaagtccaaa
gacatgaaggccaagcttgaggaggccatactgggcagcattggcgcgaggcaggaaatg
gtgcgccgcagccgggggcagctggagcggagtccatctggcagtgcttttggcagtcag
gaaaacctcagatggaggaaggacatgacccactggagacaaaacagtgaaaggatggac
aagagtcacagatcagtcaggacacgagcagagctggaacatgaagcacttatagatggg
aaccttgcaacagaggccaacttaatcattcttgatactttggagatcattgtgcagaca
gcctcagtgacagaatctaaggagagtatcctgggtggggtgctaaaggtgctgcttcac
agcatggcctgcaaccagagcgccctctacctgcagcactgctttgccacacaaagggcc
ctggtttccaagtttccagagttgctgtttgaggaggaaacagagcagtgtgccgatctt
tgtttgcgactcttaagaagctgcagcagtagcataagtaccatcaggtcccacgccagt
gcctcactctaccttctcatgaggcaaaacttcgagattggtaacaattttgcaagggtg
aaaatgcaagtgaccatgtctctgtcgtcgctggtgggaacgtcgcagaacttcaatgag
gagtttctccgtcgctcattgaaaaccatcctcacctatgcagaggaagacctagaactc
agagagaccactttcccagatcaggtccaagatctcgtgtttaatctgcacatgatccta
tctgacacggtgaagatgaaggaacaccaagaagatcctgagatgctggtagatctcatg
tataggattgcaaagggataccagacatctccagacctgcgtctgacctggcttcagaac
atggccggcaaacactcagaaaggaataaccacgctgaggctgctcagtgtttggtgcac
agcgctgctttggtagcagaatacctgagcatgctggaggaccgcaagtaccttcctgta
ggctgtgtcaccttccagaacatttcttcaaatgtgctggaggaatcagctgtctctgat
gatgtggtgtcaccagatgaagagggtatctgctcgggaaaatatttcactgaaattggt
ctagttggcctcttggaacaggcagctgcctctttttccatggctggaatgtatgaggcg
gtgaatgaagtgtacaaggtactaatcccaatccatgaagcaaacagagacgctaagaag
ctagccaccatccatggtaaactacaggaggcctttagcaaaattgtccatcagagtact
ggctgggaggatgggaagaggatgtttggtacgtacttcagagtgggtttttatggttca
aagtttggggacttggatgagcaggagtttgtctataaagagccagccatcaccaagctg
gctgaaatctctcatagactcgagaacttctatggggagcgatttggagaggaacaagtc
gaagtcatcaaggactccaacccagtagataaatgcaaacttgaccccaataaagccttt
atccagatcacatacgtggagccatatttcgacacgtacgaaatgaaagaccgcatcacc
tacttcgataagaactacaacttgagacgttttgtgtactgcactcccttcaccctggat
ggccgggctcatggggacctgcatgagcagttcaaacgcaagaccatcctcaccacatcg
cacgcctttccatacatcaagaccaggatcaacatcatccacaaggaggagatcatttcc
acacccatagaggtggcaatagaagatatgcagaagaagacgcaagagttggcctttgcc
acccatcaggacccagccgatgccaaaatgttgcagatggtcctgcagggatctgtaggc
acaactgttaaccagggtcctttggaggtggctcaggtgttcctgtcagaaatcccaatt
gacccaaaactatatcgacatcacaacaagctccgcctgtgctttaaggacttcactaag
aggtgtgaagacgccctccgaaagaacaagagcctgattggtccggaccagaaggagtac
caaagggagctagagaggaactaccacagactgaaggaggcgctgcagcccctcatcaac
aggaagatcccccagctttataaaccagtcctgcaggtcaactcgcacagagattccttc
agcagactcagtcttcgcaagcttgatatttga

DBGET integrated database retrieval system