KEGG   Cyprinodon variegatus (sheepshead minnow): 107099368Help
Entry
107099368         CDS       T06110                                 

Definition
(RefSeq) septin-7-like isoform X1
  KO
K16944  septin 7
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cvg04131]
    107099368
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cvg04812]
    107099368
   04147 Exosome [BR:cvg04147]
    107099368
Membrane trafficking [BR:cvg04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    107099368
Cytoskeleton proteins [BR:cvg04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     107099368
Exosome [BR:cvg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107099368
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase AIG1 Ras AAA_16 FeoB_N Gtr1_RagA AAA_22 Roc ABC_tran AAA_29
Motif
Other DBs
NCBI-GeneID: 107099368
NCBI-ProteinID: XP_015252936
Ensembl: ENSCVAG00000017438
UniProt: A0A3Q2EAV2
Position
Unknown
AA seq 433 aa AA seqDB search
MIERPDTAVPSIAQRNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSL
FLTDLYSKDYPGPSQRIKKTVQVEQSKVLIKEGGVQLTLTIVDTPGFGDAVDNSNCWQPV
INYIDSKFEDFLNAESRVNRRSMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHDKVNVI
PLIAKADTLTPEECQLFKKQIMKEIQEHKIKIYEFPDTEDDEDNKLIRKIKEKMPLAVVG
SNVVVEVNGKKVRGRQYPWGVAEEGIFVENGEHCDFTVLRNMLIRTHMQDLKDVTNNVHY
ENYRSKKLAAVTCNGVDTTKTKGQLTKSPLAQMEEERREHVMKMKKMEAEMEQVFEMKVK
EKKQKLKDSEAELERRHEQMKRNLEAQYKELEEKRRVFEDEKANWEAQQRILEQQKLDAS
KTMEKNKKKGKIF
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagcggccagacactgcagttccgagcatcgctcagcggaacctagaggggtat
gtgggcttcgccaatctcccaaaccaggtctatcggaagtctgtcaagagagggtttgag
tttacgttaatggttgttggtgagtctggtctcggtaaatccactctcatcaactctctg
ttcctgactgacctgtactccaaggattaccctggaccgtcgcagcgcataaagaagact
gtacaggtggaacaatccaaagttttgatcaaggaagggggtgtccagctgacactgacc
attgtggacacgccaggttttggagatgcagtggacaacagcaattgctggcagccagta
ataaactatatcgacagcaagtttgaggacttccttaacgcagagtcgagggtgaaccgt
agatccatgccggataaccgagttcactgctgcctgtatttcatcgcgccttctggccat
ggtttaaaacctctggatattgaattcatgaagaggctccatgacaaagtcaacgtcatt
cctctcatcgcaaaagccgacacactgactcctgaggagtgtcagctctttaaaaaacag
ataatgaaagagatacaggagcacaagataaaaatttatgagttccccgacactgaggac
gacgaggacaacaagctcatccgcaagatcaaggaaaagatgccactggctgtagttggc
agcaatgtggttgttgaggtgaacggcaaaaaggtcagaggtcgtcagtacccatggggc
gtggcagaagagggcatttttgttgagaacggggagcattgcgacttcactgtgctgcgc
aacatgctgatccggacacacatgcaggatctgaaggacgtcaccaacaacgtccactat
gagaattatcgcagtaaaaaactggccgctgtcacctgtaacggggtggacaccaccaag
accaaagggcagctcacaaagagtcctctggctcagatggaggaggagcgcagggagcat
gtgatgaagatgaagaagatggaggcggagatggagcaggtctttgaaatgaaggttaag
gagaagaagcagaagctgaaggattccgaggctgagctggagaggcgccacgaacagatg
aagaggaacctggaggcgcagtacaaggagctggaagagaagaggcgagtgttcgaggat
gagaaggccaactgggaggctcagcagagaatcctcgagcagcagaaactggatgcctcc
aagacgatggagaagaacaagaagaaagggaaaatcttttaa

DBGET integrated database retrieval system