KEGG   Cyprinodon variegatus (sheepshead minnow): 107099575
Entry
107099575         CDS       T06110                                 

Gene name
adamts13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cvg01002]
    107099575 (adamts13)
Enzymes [BR:cvg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     107099575 (adamts13)
Peptidases and inhibitors [BR:cvg01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   107099575 (adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin TSP1_CCN TSP1_spondin Reprolysin_3 Reprolysin_4 Reprolysin_5 Reprolysin_2 ADAM_spacer1 Peptidase_M10 Peptidase_M66
Other DBs
NCBI-GeneID: 107099575
NCBI-ProteinID: XP_015253243
Ensembl: ENSCVAG00000011153
Position
Unknown
AA seq 1401 aa
MLAAGRQEPTTPSGYGLKYKTMIVTHTFVTIHLQRDMVTNLLSRPAEVPALNANTAHCSS
LSNKVKPRLRRSTLMPDITHLELLVVVGPDVQQVHKQDTERYILTNLNIASELLRDMTLG
ANMRVHLVRMIILSQPEPEIQMSTNITSSLRSVCDWGRRINPSNDSDPLHADLLLYVTRY
DLELPDGNKQVRGVTQLGGVCSREWPCVITEDTGFDLGITIAHEVGHSFGINHDGVGNSC
SRSGFIMATDGGYNSVDLTWSPCSRQQLLTFFSEGRAECVKDFPALGGSLQDWKPGLYYG
VDDQCRIAFGSTARACSFSNPDLPACRVLSCHVKPEDVGSCKRLLVPLLDGTECAPNQWC
LKGRCVSTDDFGSSVVVNGSWSSWSEFSSCSRTCGGGVMLRTRECNNPRPAFGGIDCEGP
DIEVELCHQQPCEGTQLEFMAEQCSQTDLRPLYLLPNTASFYKWIPAIGFVKGDEQCRYM
CQSDAEDFIVSRGSHFVDGTRCESDSSTPYGATAACLRGRCQLFGCDGVLHSGKAWDVCG
VCGGNGSTCILTSDSYSGGRAKEYTTFLTLPVNASQVYIVNSGPVFTHLAVMVGGEYIVS
GTGAMSLNITHPSPLDEDYIQYRLHLTPDHLPETEEVVLPGPLKQEITIQVYRKYGPEYG
EKTNPNISFQFYVPRNKSLADSLPRGKWTAFTTPCSVTCGLGIEKHEHVCVDEHTNNLLK
PHHCKAPPPPTALHTTCQLPSCPPRWDAAGFGACSVSCGGGVRVRRVQCVQKHGSDVVKV
PDSECPSDKTPHSVEKCNLHHCPARWSVSEPGNCSAVCGPGEAKRNVSCIRREDGLDVIV
DHKYCLNQIAPPESVPCVVNVCPIGWESKREDQPSLKSSLMPRSRQAAVYVWSPVVSQCS
RTCGNGTLQVWFSCVDHETGQGVPDFHCDASSKPDPYFEMCAVYPCPPMWRSKQGVCSVT
CGGGVAKRVLYCAREADGEEEVLEDYSCSGFPKPTAVIPCNTHSCPARWKVFKTWPCSVS
CDLGVAERNVSCVQFIHGKESVVPDDSCRAAVKPAITVPCLVQVCTFKWEVKPWSQCSAP
CGYGIQSRAVFCMGPSKPEPLSPLFCMHMPKPITIQGCYKGSCGAVALNKTSPIMRTNLT
EKRLPSPVPVHEDAQNGVSVVPPIPTEAVTIPHTTTAIPTTKSGPCGQLLLEESGIVDLK
DAPSRCTVSIGRPLDEVISIKVISSSLDCRQRDYVAFFDRLAFVRKCVQAAGSELTSRTN
VLFVRQNLLTRGNGVVFTYRSERSMKRSHRQDCDIQLFSPSGIFENPVTSNASHTCRVLI
NAPPSVKIRIQALHIGLVFNTTNSQSTYIMIRDMDVLKTTVFNGQQLFLWRSSGNMAEVE
FHGDYLYSKGTFRAEYSFVRL
NT seq 4206 nt   +upstreamnt  +downstreamnt
atgttggcagctggccggcaggaaccaaccacaccctctgggtatggactgaagtataag
accatgatagtgactcacacgttcgttaccatccacctccagagagacatggtcactaac
ctgttgtctcgtcctgcagaggtccctgccttaaacgccaacactgctcactgcagttct
ctttccaataaagtaaagcctcgattacgtcgctctactctgatgccagacatcacacac
ctagagctgctggtggttgtggggcccgacgtccagcaggtccacaaacaggacacagaa
cgatatattctcaccaacctaaatattgcgtctgagctgctcagagacatgactctgggt
gccaacatgagggtacacctggtccgcatgatcatcctgtcacagcccgagccagagatc
caaatgtccaccaacatcacttcctctctgaggagtgtgtgtgactggggcagaaggatc
aacccctccaatgactcagacccactacatgcagacctcctgttatatgtaacaaggtac
gatctggagctgccagacgggaacaaacaggtcagaggggtgacacagcttggaggggtc
tgctccagggaatggccctgcgtgatcacagaggacacaggcttcgacctgggcatcacc
atcgctcatgaagttggacatagttttggaatcaaccacgacggggtagggaacagctgc
agccggagcggcttcataatggccacagacggaggctataacagtgtggatttgacctgg
tccccctgcagcagacagcagcttctcaccttcttcagtgaaggtagggctgaatgcgtc
aaagatttccctgcactcggaggctccctacaggactggaagccagggttgtattatgga
gttgatgaccaatgtcgtatagcttttggcagcactgcaagagcctgctccttctccaat
cctgacctgccagcttgccgtgttctgtcctgtcacgttaaacctgaagatgtcggctcc
tgtaaacgcctcctggttcctttgctggatgggacagagtgtgcacccaatcagtggtgt
ttgaagggacgctgtgtgtccacagatgactttggttcctctgtggtggtcaatggctcc
tggtccagctggtctgagttttcgtcctgctccaggacatgtggcggaggagtcatgctc
cgtaccagggaatgcaacaacccaagacctgcttttggagggattgattgtgagggtcca
gatattgaggttgaactttgtcaccaacagccttgtgaggggacccagctggagttcatg
gcagagcagtgttctcaaacagacctccgacctctgtacttgctacccaacactgcttcc
ttctacaaatggatcccagctattggatttgttaaaggcgatgagcagtgcaggtacatg
tgccagtcagatgcagaggacttcatagtgagccgtgggtctcattttgtggatggtact
cgctgtgagtcagatagctcaactccatacggcgcaacagctgcttgtctcagaggcaga
tgccagctgttcggctgtgatggagtgctacactctgggaaagcgtgggatgtttgcgga
gtgtgtggtggaaatgggtcgacctgcattttgacatctgactcctacagcggcggtcgc
gccaaagagtacaccacttttctcactctgccagttaatgcctcccaggtctatattgtc
aacagtggacctgtttttactcatttagctgtaatggttgggggtgagtacattgtgtct
gggactggtgccatgtctttgaatatcacccacccctcaccgctagatgaagactacatt
cagtaccgccttcacctcactccagaccatttacccgagacagaagaagtggttctacct
ggacctcttaaacaggagataaccatacaggtctatcgtaaatatggaccagaatatggt
gaaaaaacgaatccaaacatcagctttcagttctatgtgccaagaaacaagagcttggct
gacagcttaccgagaggaaaatggactgctttcacaacaccttgctctgtcacttgtgga
ttgggtatagaaaagcatgagcatgtctgtgtagatgaacacaccaacaaccttttgaag
ccacaccactgtaaagctcctcctccgcctacagcgctgcacacaacctgtcagctccca
tcctgcccccccaggtgggatgcagcaggttttggggcttgcagcgtctcctgtgggggg
ggagttcgggtgcgtcgtgtgcaatgtgttcaaaaacatggatccgatgtggtaaaggtt
ccagattcagagtgtccctcagataaaactccccactctgtggaaaaatgtaaccttcac
cactgccctgccagatggtctgtgtcagaaccaggaaactgttcagcagtgtgtggacca
ggagaagcaaaacgcaacgtgtcatgtatccgacgagaagacggattggatgtcatagtg
gatcataaatattgcttaaatcagatcgcacctccagaatcagtgccctgtgtggtaaac
gtctgccccattgggtgggaatctaagcgagaggatcagcctagtttgaagtctagcttg
atgccacgttccagacaggctgctgtgtacgtctggagtcctgttgtcagccagtgttcc
aggacctgtgggaatggaaccctacaggtgtggttttcttgtgtggatcacgagacggga
cagggggttcctgacttccactgtgacgcttccagcaaacctgatccttactttgagatg
tgtgctgtttatccctgccctccgatgtggcgctctaagcaaggagtgtgcagtgtaacg
tgtggaggaggggtagccaagagagttctgtattgtgctcgagaggcagatggggaggag
gaggtgttggaggattacagctgcagtggctttcccaaaccaacagccgtgattccatgt
aatactcacagctgccctgcaaggtggaaggtattcaagacatggccctgctctgtatcc
tgtgacctgggtgtagctgagaggaatgtgtcttgtgtccaatttatccatggtaaagag
agcgtggtgccagatgatagctgcagggcagccgtcaaacctgccatcacggtgccttgc
ctagtgcaagtgtgcaccttcaagtgggaggtgaagccatggagccagtgctcagcaccc
tgtggatatggtatccagtccagagccgtcttctgcatgggcccctcgaagcccgagccc
ctcagccccctgttttgcatgcacatgcccaaacccatcaccatacagggctgctacaaa
ggcagctgtggagctgtagccttgaacaaaacctccccaattatgagaacaaacctcaca
gaaaagcgtctcccatctcccgttccggtacatgaggatgcccagaacggcgtcagcgtt
gttcctccgattccaacagaggccgtaaccatcccacatactaccacagccattccgacg
acaaagtctggtccatgtggacagctactcctggaggaatcgggcattgtggatttaaag
gatgcgccgagcagatgcacggtgtcgataggtcgaccccttgacgaggtcatcagtatt
aaagtcatatccagttctttggattgcagacaaagggactatgtagcgttttttgatcgc
ctggcctttgtgaggaagtgcgttcaagcagcaggcagtgaactgaccagcagaaccaat
gtcctgtttgttcgccaaaatctgctcacccgtggaaatggggttgtgtttacctataga
tcggagaggagtatgaaaaggagccatcgtcaggattgcgacattcagcttttttccccc
agcggcatttttgagaatccagttacgtcgaacgccagccacacctgccgagtgctcatc
aacgcccctccttcagtgaagatcaggatccaggcgctgcacataggattagtattcaac
accaccaactcccagtctacatacattatgatccgggacatggacgtcctaaagaccact
gtgtttaacggccagcagctgttcctgtggcgctcctctggaaatatggcggaggttgaa
tttcatggtgattacctgtattccaaagggaccttcagagctgaatattcctttgtgcgt
ctttga

DBGET integrated database retrieval system