KEGG   Cyprinodon variegatus (sheepshead minnow): 107099636Help
Entry
107099636         CDS       T06110                                 

Definition
(RefSeq) L-amino-acid oxidase-like
  KO
K03334  L-amino-acid oxidase [EC:1.4.3.2]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg00250  Alanine, aspartate and glutamate metabolism
cvg00270  Cysteine and methionine metabolism
cvg00280  Valine, leucine and isoleucine degradation
cvg00350  Tyrosine metabolism
cvg00360  Phenylalanine metabolism
cvg00380  Tryptophan metabolism
cvg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cvg01100  Metabolic pathways
Module
cvg_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107099636
   00270 Cysteine and methionine metabolism
    107099636
   00280 Valine, leucine and isoleucine degradation
    107099636
   00350 Tyrosine metabolism
    107099636
   00360 Phenylalanine metabolism
    107099636
   00380 Tryptophan metabolism
    107099636
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    107099636
Enzymes [BR:cvg01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.2  L-amino-acid oxidase
     107099636
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox_2 FAD_binding_2 Thi4 Pyr_redox AlaDh_PNT_C DAO FAD_oxidored FAD_binding_3 HI0933_like Lycopene_cycl MCRA Pyr_redox_3 GIDA Trp_halogenase NAD_binding_7 3HCDH_N NAD_binding_9 TrkA_N MtrD
Motif
Other DBs
NCBI-GeneID: 107099636
NCBI-ProteinID: XP_015253335
Ensembl: ENSCVAG00000009160
Position
Unknown
AA seq 520 aa AA seqDB search
MNLLVKLFLFGFGLLIVFYFHCCAVRKEITIAECLKDPDYNELLEIANNSLSKTDNPRHV
VIVGAGMAGLTAAKLLEDAGHKVTILEASGRVGGRVETYRNKDENWYAEIGAMRFPQSHK
IVFTFAEKLNVTFRNFTMDDNNTYYFVNGVKKRNHEVKKNPDILGYNVTKEEKGKSAEQL
LEQSLLKVRNDIENGGCDIILEKYDRYTVKEYLKEVGKLSNEAIRMIGDLLNEQSLMYTA
FTEMLYDQADVNNSVRYHEVDNGTEQLPNAFLKVLSTQPNLNATVQSINRKENGVVVAYM
ENQQLKHIKADYALVTTTAKAALYMDFDPPLTVKKMVALRTVHYDSATRITMTFSEKFWE
KDGIKGGKSVTDRPSRFIYYQSHDFPENHTIGVILASYTWSDDSSLFLGARDEQLKEVLL
RDLAEIHGPHVKSLCTGILVKKWSLDPYSFGAFALFTPYQHRQYADELFKNEGRIHFAGE
HTALPHAWIEGSMKSAIRAARNINHHAMQHLDSNQDRDEL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaatctccttgtaaaactttttttgtttggctttggcttgctcattgtgttttacttt
cattgctgcgccgtcagaaaggagataactatcgctgaatgtttgaaggatcctgactat
aatgagctactggaaatagcaaacaacagcctgtcaaagacagacaaccctcgtcacgtt
gttattgtcggagctggtatggctggactgacagcggcaaagctgctggaagatgccgga
cataaagtcaccatattggaggccagtggtcgagttgggggacgagtggagacctacagg
aataaagacgaaaactggtatgcagaaataggggccatgagatttccccaatctcacaag
atagtttttacctttgctgaaaagctgaatgtgacgttcaggaacttcactatggatgac
aacaacacatattactttgtcaatggggtgaagaaaaggaatcatgaagtgaagaaaaat
cctgacattctggggtacaatgtgacaaaagaggagaaggggaagtcagctgaacaactg
ttggagcaaagtttgcttaaggttagaaatgacatagaaaatggtggctgtgatataata
ctggagaaatacgacagatacactgtaaaggaatatttgaaagaagttggaaagcttagc
aacgaggccatcaggatgataggagatctacttaatgagcagagcctcatgtacacagcc
ttcactgagatgctctatgaccaagctgacgtcaataattctgttcggtaccacgaggtg
gataatggcacggagcaactccccaatgcttttcttaaggtcctttccactcaacctaat
ttgaatgctaccgttcagtctatcaaccgtaaagaaaacggtgtcgttgtagcgtacatg
gaaaaccaacagctcaaacacattaaagcagattatgctctggtcacaactactgccaaa
gctgctctttacatggactttgatccaccccttacggttaaaaagatggtggcattaaga
acagttcattatgacagtgccaccagaatcactatgacgttcagtgaaaagttctgggag
aaagatggcatcaaagggggaaaaagcgtgacagaccgaccctctcgtttcatctactac
cagagccacgatttcccggaaaaccacactattggagtgatcctagcctcctatacctgg
tctgatgactccagcctcttcctcggtgccagagatgaacagctgaaagaggtgcttctc
agagatttagctgagatccatggtccccacgtcaaatccctctgtaccggtattctggtg
aagaaatggagtctcgatccatatagttttggtgcctttgcacttttcacaccttatcaa
cacaggcagtatgctgatgagctctttaagaatgaaggcaggattcattttgctggtgag
cacacggccctccctcatgcttggatcgaagggtctatgaaatctgcaatcagggcggct
cggaatatcaatcatcatgcaatgcagcatttggattcaaaccaagatagagatgagctt
taa

DBGET integrated database retrieval system