KEGG   Cyprinodon variegatus (sheepshead minnow): 107100378Help
Entry
107100378         CDS       T06110                                 

Gene name
mrpl22
Definition
(RefSeq) 39S ribosomal protein L22, mitochondrial
  KO
K02890  large subunit ribosomal protein L22
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    107100378 (mrpl22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cvg03011]
    107100378 (mrpl22)
Ribosome [BR:cvg03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    107100378 (mrpl22)
  Bacteria
    107100378 (mrpl22)
  Archaea
    107100378 (mrpl22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 107100378
NCBI-ProteinID: XP_015254318
Ensembl: ENSCVAG00000021059
Position
Unknown
AA seq 208 aa AA seqDB search
MAAAMTGRGVAFIRNIAGSLHSRLPTLGGASQQLSCLHTSISLNSKHWEKNNHKVYPPQL
QDEPRRPAEVYHSRRQIKYSKDKMWYLAKMIRGMSIDEAIAQLEFNDKKGAKIMKEVLLE
AQEMAVKNHNVEYKSNLYVAESFSGKGKYLKRIRYHGRGMFGIMDKVYCHYFVKLVEGVP
PKPEQSTSFDQAKEYVQSLKNRTIIHSL
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgcaatgacaggtcgtggtgtcgctttcattaggaatatagctgggtcgctt
cactcgagattaccgactctgggtggtgcatcacagcagctctcatgcctccacacaagc
atttcattaaattccaaacactgggagaagaacaaccataaagtatatcctcctcagctg
caggacgagccccgcagacctgcagaggtttatcacagcaggaggcagataaagtacagc
aaggataagatgtggtacttggccaaaatgatccgggggatgagcatcgacgaagctatt
gcacagctggaattcaatgacaagaaaggagcaaagatcatgaaagaggttcttcttgaa
gctcaagagatggcggtcaagaaccacaatgtagagtataaatccaacctctatgtagct
gagtcattctcgggcaaaggcaaatacctaaagaggatccgctaccatggcagaggcatg
tttggcatcatggacaaagtttattgccactactttgtgaagctggttgagggtgtgcca
cccaaaccagagcagagtactagctttgatcaagccaaagagtatgtccaaagcttgaag
aaccggaccatcatccacagcctttag

DBGET integrated database retrieval system