KEGG   Cyprinodon variegatus (sheepshead minnow): 107100543
Entry
107100543         CDS       T06110                                 

Definition
(RefSeq) N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming) B-like isoform X1
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107100543
Enzymes [BR:cvg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     107100543
SSDB
Motif
Pfam: AstE_AspA RRM_1
Other DBs
NCBI-GeneID: 107100543
NCBI-ProteinID: XP_015254549
Ensembl: ENSCVAG00000016130
UniProt: A0A3Q2E8U8
Position
Unknown
AA seq 329 aa
MQVDEPLLLPRLSRVAVCGGTHGNELSGVYLVQEMMKTQKGGEDREPASVSMLLSNPRAM
QHCRRYVDIDLNRCFTHATLNGPISERAPYEIIRARELNAMLGPKGSRAAVDLVCDLHNT
TANMGLCFIAYSDCDWICLHIFKYLQKQMPNMPMRFIHFDIPNKESYSLDSIGKHGFAME
IGPQPHGCVKSNIYTAMKEGVQHMLDWAGYFNSGCVFEGGSVEVFTLVKNIDYPREGGTH
NITATIHPYLQDRDFCLLHPGDPLFQTFSGETLLYKGKEPLYPFFINECAYYEKGIALSL
ARKKTVTIPSIWVQTEKEEEQSFTSEEEE
NT seq 990 nt   +upstreamnt  +downstreamnt
atgcaggtggatgagccgttgcttttgccaaggttatcccgagttgctgtttgtggcggg
acgcatggcaacgaactgtcaggagtgtacttggtgcaagagatgatgaaaacacagaaa
gggggagaggacagagagcccgcgtctgtgtcgatgttgctgtccaaccctcgggccatg
cagcattgccgcagatatgttgacatcgacctgaaccgctgcttcacccatgcaaccctc
aatggccccatatcagagagggccccctatgaaatcattcgggctcgtgagctaaacgcc
atgctgggtcccaaaggcagccgggcggcagtggatctcgtctgtgacctccacaacacc
actgccaacatgggcctgtgcttcatcgcctattccgactgtgactggatctgtcttcac
atattcaaatacctgcagaagcagatgccaaatatgccgatgagattcatccattttgat
attcctaataaagaatcatattccctcgattcaatcggaaaacacggctttgctatggag
atcggccctcagccccacggctgtgtcaagtcaaacatctacacggcaatgaaagaaggt
gtgcagcacatgctggactgggcaggctattttaactcaggttgtgtgtttgaaggagga
tcggtggaggtgttcaccttggttaaaaacatcgactacccgagagaaggtgggactcac
aacatcacagcaaccatccatccctacctccaggaccgagacttctgcctgctgcacccc
ggagaccctctgttccagacgttctcaggagaaaccctgctatataagggcaaagaacca
ctttatcccttcttcatcaacgaatgtgcctactatgaaaagggcatcgcactctccctg
gccagaaagaagaccgtgaccatcccttctatctgggtgcaaacagagaaggaggaggag
cagagctttacatcagaggaagaggagtga

DBGET integrated database retrieval system