KEGG   Cyprinodon variegatus (sheepshead minnow): 107100765Help
Entry
107100765         CDS       T06110                                 

Gene name
tspan12
Definition
(RefSeq) tetraspanin-12 isoform X1
  KO
K17355  tetraspanin-12
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    107100765 (tspan12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin
Motif
Other DBs
NCBI-GeneID: 107100765
NCBI-ProteinID: XP_015254882
Ensembl: ENSCVAG00000008824
UniProt: A0A3Q2CNQ0
Position
Unknown
AA seq 315 aa AA seqDB search
MAQEDAVRCLRCLLYALNLLFWLMSVCVLGVAAWIRDTLNTVLTLTAHTRLEDAAVLTYS
PAVHPVLICVCCLLLIVAMVGYCGTLRSDLLLLSWYFCSLLVIFCVELASAVWTYDEPSV
QRADMISLKFRMPNYGLQRYQWLTHTWDSFQTQFKCCGVIYFTDWLEMTEMEWPPDSCCT
HQYPGCARHAHQHDLSDLHQEGCGPKIYSFIRGTKQLQVLRFLGVSIGVAQILAMALTLT
LLWALYYGRQFQKPNSEATPVLPEDCVSIAATNGTTTGSSKYGCSHMMKGRTDMSAAQAE
LRDAQVEAEWLNAAG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggaggatgcagtgaggtgtctgcgctgcctgctctatgcgctgaacctgctg
ttctggctgatgtcggtgtgtgtgctcggtgtggcagcctggatcagagacaccctgaac
accgtcctgaccctgacagcccacaccaggttggaggatgctgcggtcctcacctactct
ccggcggtccatccggtcctcatctgcgtgtgctgcctcctcctcatcgtggccatggtt
gggtactgcggcacgctgcggtccgacctgctactgctctcctggtacttctgcagcctg
ctggtgattttctgtgtggagttggcctctgctgtgtggacctacgacgagccctcagta
cagcgagctgacatgatcagtctgaagtttcggatgccgaactacggcctgcagcgatat
cagtggctcacacacacctgggacagcttccagacacagtttaaatgctgtggggtgatc
tacttcaccgactggctggagatgacagagatggagtggcctcctgactcctgctgcacc
catcagtacccgggctgcgctcgccacgcccaccagcatgacctcagcgacctccaccag
gagggctgcggtccgaagatctacagcttcattcgagggacgaagcagcttcaggtgctg
cgattcctgggggtctctatcggcgtggcacagatcctggccatggcgctgacgctcacg
ctgctttgggcgctctattacggcagacagtttcagaaaccgaactcagaggcgacacct
gtgctgcctgaagactgtgtttccattgcagcaaccaatggaaccactaccggatcctcc
aaatatggctgcagccacatgatgaagggacgtacggacatgtctgctgctcaggctgag
ctgagagatgctcaggtggaggcggagtggctgaacgctgcaggataa

DBGET integrated database retrieval system