KEGG   Cyprinodon variegatus (sheepshead minnow): 107102290
Entry
107102290         CDS       T06110                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg00230  Purine metabolism
cvg00240  Pyrimidine metabolism
cvg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107102290
   00240 Pyrimidine metabolism
    107102290
Enzymes [BR:cvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     107102290
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_17 AAA_28
Other DBs
NCBI-GeneID: 107102290
NCBI-ProteinID: XP_015257019
Ensembl: ENSCVAG00000015882
Position
Unknown
AA seq 259 aa
MATPPKRLRGSSRRHRKVSIEGNIAAGKSTFVRLLQASSCSSDWEVIPEPIGKWCNVQNS
EDIYQELSSSQKSGGNLLQMLYDKPSRWAYTFQSYACLSRVRSQLQSPSAKLLQAENPVQ
FYERSVYSDRLVFASSLFESGDLLETEWSVYQDWHSWLLKQFEADIALDGIIYLRAPPKR
CMQRLLHRGREEEQGVPLEYLEQLHLKHEAWLYHRNLRMDFEYLQDLPVLVLDVDKDFQN
DPIKQEDILEKVKDFLTLL
NT seq 780 nt   +upstreamnt  +downstreamnt
atggccacccctcctaagcggctccgtggttcttcacgcagacaccggaaggtctccatc
gaggggaacatcgctgcagggaaatctaccttcgtccgcctgctgcaggcctcctcctgc
tcctcggactgggaggtgatcccagaaccgatcgggaaatggtgcaacgtccagaacagt
gaggacatctaccaggagctgagttcctcgcagaagagtggagggaacctcctgcagatg
ttgtacgacaaaccgagccgctgggcatacaccttccagagctacgcctgcctcagcaga
gttcgttctcagcttcagtctccgtcagctaaactactccaggcagaaaacccggttcag
ttctacgagcgatccgtttactcagacaggttggtgtttgcatccagcctgtttgagagt
ggcgacctgctggagacggagtggagcgtctaccaggactggcacagctggctgctgaag
cagttcgaggccgacatcgcactggacggcatcatctacctcagagcccccccaaagcgc
tgcatgcagcggctgctgcaccgcggccgcgaggaggagcagggcgttcctctggagtac
ctggagcagcttcacctcaaacacgaggcgtggctctaccacaggaacctcaggatggac
tttgagtacctccaagaccttcctgtcttggttctggatgtggataaagacttccagaac
gatccgatcaagcaggaggacatcctagaaaaggtcaaagacttcctcaccctgttgtga

DBGET integrated database retrieval system