KEGG   Cyprinodon variegatus (sheepshead minnow): 107103450
Entry
107103450         CDS       T06110                                 

Gene name
rdh5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    107103450 (rdh5)
Enzymes [BR:cvg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     107103450 (rdh5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776 Phage_rep_O
Other DBs
NCBI-GeneID: 107103450
NCBI-ProteinID: XP_015258649
Ensembl: ENSCVAG00000017796
UniProt: A0A3Q2D8H5
Position
Unknown
AA seq 347 aa
MFFEFGSQKQTPEGNMDSQYIYELLGENAWYYIAASFALLWILVWLYRDSLEIGNVSDKY
VFVTGCDTGFGNLLCKKLDRRGFRVLAGCLTEKGADDLKRVAGPHLKTVLLDVTSQSSIQ
TAMEWTKKEVGDRGLWGIVNNAGRSLPMGPSEWMRVEDFHNVLKVNMNGVIAMTMTFLPL
IKKARGRIVNVASVLGRVAANGGGYCISKFAVECFSDCIRRDISYFGIKVCIIEPGFFKT
AVTSLDPIERELHRLWNQLSPEVKASYGEKYLDNYIKIQRLIMNAVCDSDLSKVTSCMEH
ALTAAHPRTRYSAGWDAKLLWIPLSYMPSFVVDIGLRLVLPRPSKSV
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgttttttgaatttggaagccaaaagcaaactcctgaaggtaacatggattcacagtac
atatacgaacttttaggtgaaaacgcctggtactacatcgcagcttccttcgctttgctt
tggattctggtgtggctttacagagacagcctggaaatagggaatgtctcagacaaatat
gtctttgtgactggctgtgacacaggatttgggaaccttttgtgtaagaagcttgaccgt
agaggttttcgtgttctagccggctgtctcacagaaaagggagctgatgatctgaaaaga
gttgcagggcctcacctgaagacggtcctgctggatgtgaccagtcagagcagcatccag
actgccatggagtggacaaagaaggaggttggtgatagaggactttggggtattgtgaac
aatgccggacgttccttacctatgggtccttcagagtggatgagagtggaggatttccac
aatgtactgaaagtgaacatgaatggagtgattgccatgactatgaccttcctgcccctt
atcaaaaaggcccgtggacgcatagtaaacgtggcatctgtcctaggcagggtggctgca
aatggtggcggatactgcatctccaagtttgcagtggagtgtttctctgactgcatcagg
agagatataagctactttggaatcaaagtgtgtatcattgagccggggtttttcaagaca
gctgtgaccagccttgatcccatcgagcgggagctgcaccgtctatggaatcagctcagc
cctgaagtaaaagcaagctatggagaaaaatacctggataactacatcaagatccagcgt
ttgatcatgaatgctgtgtgtgactcagaccttagcaaggtgaccagctgcatggagcat
gctctgactgcggctcacccacgcacgcgatacagtgccggctgggacgccaagcttcta
tggatccctctctcttacatgccttcctttgtggttgatattggactgaggctggtgctg
cctcggccttccaagagtgtttaa

DBGET integrated database retrieval system