KEGG   Cyprinodon variegatus (sheepshead minnow): 107104256Help
Entry
107104256         CDS       T06110                                 

Gene name
cpt1a
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform isoform X1
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg00071  Fatty acid degradation
cvg01212  Fatty acid metabolism
cvg03320  PPAR signaling pathway
cvg04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107104256 (cpt1a)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107104256 (cpt1a)
   03320 PPAR signaling pathway
    107104256 (cpt1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cvg03029]
    107104256 (cpt1a)
Enzymes [BR:cvg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     107104256 (cpt1a)
Mitochondrial biogenesis [BR:cvg03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    107104256 (cpt1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 107104256
NCBI-ProteinID: XP_015259704
Ensembl: ENSCVAG00000000813
Position
Unknown
AA seq 772 aa AA seqDB search
MAEAHQAVAFQFTVTPDGIDLQLCHEALRQVYLSGLHSWKKRFIRFKNGVMTGVYPGSPA
GFMIVVVSYMSYNKYKQLDPSMGLIAKLGQHIPISQYMSTDSQRIVGGVLVGTGLWVTII
MIMRNVLKCLLSWHGWMESRHGSLPFGTRLWLLLVKVFSGRKPMLYSFQNSLPRLPVPSV
KDTCRRYLESVRPLMDDEQFERMKALSKDFEKNLGPRVQWYLKLKSWWASNYVSDWWEEY
IYLRGRGPIMVNSNYYAMDFLYVCPTNSQAARAGNAIHAIMLYRRKLDRAQIKPIYLLAN
KVPLCSAQWERMFNTSRIPGVETDTLQHMNESKHIAVYHKGRFFKVWVFYDGRLLLPREI
EQQMERILADKSEPLPGEEKLAALTAGDRTPWAKARQQFFKNGKNKQSLDAIEKAAFFVS
LDDTEQRYDADNQVKSLDSYAKCLLHGNCYDRWFDKSFNLIIFKNGTMGLNAEHSWADAP
IVGHLWEQVLYMDCKLGYTEDGHCHGKPHPNLPGPQKLQWDIPAECQEVIESSLTVARAL
ADDVDCHIIPFDDFGKGLIKKCRTSPDAFIQIALQLAHYRNKGKFCLTYEASMTRLFREG
RTETVRSCTVETCDFVRAMIRDETREERLRLLKVAAEKHQSLYRLAMTGQGIDRHLFCLY
VVSKYLGEESAFLKEVLSEPWRLSTSQTPLQQIELFDLVRHPELASSGGGFGPVADDGYG
VSYIILGDDLINFHISSKYSSPETDSRRFGENIRQAMLEMLALFQLEKKESK
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagctcaccaggcggtggcctttcagttcaccgtcacccccgatggcatcgac
ctacaactgtgccacgaggctctacgccaggtctacctttctgggcttcactcctggaag
aaaaggttcattcggtttaagaatggggtaatgactggcgtgtacccaggcagcccggct
ggcttcatgatcgtggtcgtttcatacatgtcctacaacaaatacaaacagctggatcct
tccatgggactgattgccaaattaggccaacacatacccatcagccaatacatgtccaca
gatagccagaggatagtcggaggggttctggtgggcacgggcctctgggtcaccatcatt
atgatcatgaggaatgttctgaagtgcctgctgtcatggcacggctggatggagtcacgc
cacgggtctctgcccttcggtactcgcctgtggctgcttttggtgaaggtgttctctggc
agaaagccgatgctctacagtttccagaactccctgccgcggctacctgttccctcagtc
aaggacacctgcagaaggtacctggagtcggtgcgcccactgatggatgacgagcagttt
gaaaggatgaaggccttgtctaaagactttgagaagaatctaggacccagggtgcagtgg
tacctcaaactcaaatcctggtgggcttcaaactatgttagtgactggtgggaagagtat
atttacctgagaggccgtggccccatcatggtcaacagcaactattatgccatggacttt
ctgtatgtgtgccccaccaacagccaggcggcccgggcaggtaatgctattcatgccatc
atgctctacaggagaaaactggacagagctcagatcaaaccaatatacttgctggccaac
aaggtacctctgtgttctgctcagtgggagcgcatgtttaacacctcccgcatccctggt
gtggagacagacacgctccagcacatgaacgagagcaaacacattgctgtgtaccataaa
ggccgtttcttcaaggtgtgggtgttttacgacggacggctgctgctgccacgagagatc
gagcagcagatggagaggatcttggcggacaagtctgagcccttgccaggagaggaaaaa
ctagctgcgctgactgcaggagacaggaccccttgggcaaaggctcgacaacagttcttc
aaaaatggcaaaaacaagcaatctctggatgccatagagaaggcagccttctttgttagc
cttgatgatacagagcagcgctacgatgcagacaaccaggtcaagtctctggacagttac
gccaagtgcctgctgcatggaaactgctacgacagatggtttgataagtcctttaatctg
atcattttcaagaatgggaccatgggactaaatgcagagcactcttgggctgatgctcca
atcgttggccatctgtgggagcaagtattgtacatggattgtaaactgggatatactgag
gatggccactgccatgggaagcctcatcccaatttgcctggtccccagaagctacagtgg
gacatcccagctgagtgtcaggaggttattgagagctcactaacagtagccagggctctg
gcagacgatgtggactgccacataatccccttcgatgactttggaaaggggttgatcaag
aagtgccgcaccagtccagatgcctttatccagatcgccctgcagctggcccattacaga
aacaaagggaagttctgcctgacgtatgaggcgtccatgacgcggctcttccgtgagggt
cgaacagaaactgtacgttcctgcaccgtggagacttgtgactttgttcgtgccatgatc
agagacgaaacgagagaagagcgccttagattgctcaaagtggcggcagagaaacaccaa
agcttgtaccgcttggcgatgacgggtcagggcatcgatcgccaccttttctgtctctat
gtggtctctaagtacctgggagaggaatcagccttcctcaaggaggtgttgtctgagcca
tggaggttgtccaccagtcagaccccgctgcagcagattgagttgtttgatctggtcaga
catccagagttggcatcctccggaggtggattcggtccagtggctgacgatgggtatggt
gtctcctacatcattcttggggacgacctcatcaacttccatatctccagcaaatactca
agcccagaaactgactcccgtcgttttggggaaaacattagacaggccatgttggaaatg
ctggctctcttccagcttgagaagaaagagtcaaagtga

DBGET integrated database retrieval system