KEGG   Chromobacterium violaceum: CV_1412
Entry
CV_1412           CDS       T00147                                 

Symbol
pflB
Name
(GenBank) formate C-acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
cvi  Chromobacterium violaceum
Pathway
cvi00620  Pyruvate metabolism
cvi00640  Propanoate metabolism
cvi00650  Butanoate metabolism
cvi01100  Metabolic pathways
cvi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CV_1412 (pflB)
   00640 Propanoate metabolism
    CV_1412 (pflB)
   00650 Butanoate metabolism
    CV_1412 (pflB)
Enzymes [BR:cvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     CV_1412 (pflB)
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: AAQ59087
LNCC_Brazil: CV1412
UniProt: Q7NY63
Position
1488143..1490470
AA seq 775 aa
MDAITQNATQANPWRDFVAGDWQSKVDVRNFIQLNYQPYEGDDSFLAGATERTKKLWDTL
GELLKQERAKGVLDVSADRGSSITAHDAGYIDQANEVIVGLQTDAPLKRAIMPNGGLRMV
ENGLEAFGFKLDPMIKEVWEKYRKSHNQGVFDVYTPEIMACRKSGVITGLPDAYGRGRII
GDYRRVALYGTDFLRAERQQVFHELDNATFTDDVMRLREELSEQFRALDELKQMAAKYGY
DISRPAANAREAVQWVYFAYLAAVKEQNGAAMSFGRVSTFLDIYIERDIAAGVLTEEQAQ
EMIDDLVIKLRIVRFLRTPEYDQLFSGDPTWVTESIGGMGQDGRTLVTKNSFRFLNTLYN
LGPAPEPNLTVLWSTRFPQGFKNFCAKVSIDTSAIQYENDDLMLPYWGDDYGIACCVSAM
KIGKQMQFFGARANLAKALLYAINGGRDEKSGALVAKGFEPITSDVLTYDELMPKFEKMM
DWLAATYVKALNCIHYMHDKYAYERIEMALHDRDIVRTMACGIAGLSVAADSLSAVKFAK
VHIIRNEEGLAVDYKIEGDYPAYGNNDDRVDDIAVWLTQTFMDRIKAQPYFYRDSKPTQS
VLTITSNVVYGKKTGNTPDGRRAGEPFSPGANPMNGRDVKGFVAAGASVAKLPYDSALDG
ISWTASATPDALGHTAEERILNLANCLDGFCSAHPTEFSSANCTPFDCEGERHIAGGGFH
VNVNVFKRETLLDAMEHPELYPQLTIRVSGYAVNFIKLTREQQLDVINRTFHGKM
NT seq 2328 nt   +upstreamnt  +downstreamnt
atggacgccatcactcagaatgctacccaagccaacccgtggcgcgatttcgtcgccggc
gactggcagagcaaggtcgatgtccgcaacttcatccagctgaactatcagccgtacgaa
ggcgacgacagcttcctggctggcgccaccgagcgcaccaagaagctgtgggataccctg
ggcgaactgctgaagcaggaacgcgccaagggcgtgctggacgtgtccgccgaccgcggc
tcctccatcaccgcgcatgacgccggctacatagaccaggccaacgaagtgatcgtcggc
ctgcaaaccgacgccccgctgaagcgcgccatcatgccgaacggcggcctgcgcatggtc
gagaacggcctggaagccttcggcttcaagctggacccgatgatcaaggaagtgtgggaa
aagtatcgcaagagccacaaccagggcgtgttcgacgtctacaccccggaaatcatggct
tgccgcaagtccggcgtgatcaccggcctgcccgacgcctacggccgcggccgcatcatc
ggcgactaccgccgcgtggccctgtacggcaccgacttcctgcgcgccgagcgccagcaa
gtgttccatgaactggacaacgctaccttcaccgacgacgtgatgcgtctgcgcgaagag
ctgtccgaacaattccgcgcgctggacgaactgaagcagatggccgccaagtacggctac
gacatcagccgtccggccgccaacgcccgcgaagcggtgcaatgggtgtacttcgcctac
ctggccgccgtcaaggaacagaatggcgccgccatgtccttcggccgcgtgtccaccttc
ctggacatctacatcgagcgcgacatcgccgccggcgtgctgaccgaagagcaagcccag
gaaatgatcgacgacctggtgatcaagctgcgcatcgtccgcttcctgcgcacgccggaa
tacgatcagctgttctccggcgacccgacctgggtgaccgaatccatcggcggcatgggc
caggacggccgcaccctggtgaccaagaacagcttccgcttcctgaacaccctgtacaac
ctgggcccggcgccggagccgaacctgaccgtgctgtggtccacccgcttcccgcagggc
ttcaagaacttctgcgccaaggtgtccatcgataccagcgccatccagtacgaaaacgac
gatctgatgctgccttactggggcgacgactacggcatcgcctgctgcgtgtcggcgatg
aagatcggcaagcagatgcagttcttcggcgcccgcgccaacctggccaaggccctgctg
tacgcgatcaacggcggccgcgacgagaagtccggcgcgctggtggccaagggtttcgag
ccgatcaccagcgacgtgctgacctacgacgagctgatgcccaagttcgagaagatgatg
gactggctggccgccacctacgtcaaggcgctgaactgcatccactacatgcacgacaag
tacgcctacgagcgcatcgaaatggcgctgcacgaccgcgacatcgtccgcaccatggct
tgcggcatcgccggcctgtccgtggccgccgactcgctgtccgccgtcaagttcgccaag
gtgcacatcatccgcaatgaggaaggcctggccgtcgactacaagatcgaaggcgactac
ccggcttacggcaacaacgacgaccgcgtcgacgacatcgccgtgtggctgacccagacc
ttcatggatcgcatcaaggcccagccgtacttctaccgcgactccaagccgacccagtcg
gtgctgaccatcacctccaacgtggtgtacggcaagaagaccggcaacacgccggacggc
cgccgcgccggcgaaccgttctccccgggcgccaacccgatgaacggccgcgacgtgaag
ggcttcgtcgccgcgggcgcctcggtggccaagctgccgtacgactccgcgctggacggc
atcagctggaccgcttcggccacgccggacgcgctgggccacaccgctgaagagcgcatc
ctgaacctggccaactgcctggatggcttctgctccgcgcacccgaccgagttcagcagc
gccaactgcacgccgttcgactgcgaaggcgagcgccacatcgccggcggcggcttccac
gtcaacgtgaacgtgttcaagcgcgaaaccctgctggacgcgatggagcatccggaactg
tacccgcagctgaccatccgcgtgtcgggctacgccgtgaacttcatcaagctgacccgc
gaacagcaactggacgtgatcaaccgcaccttccacggcaagatgtaa

DBGET integrated database retrieval system