KEGG   Chromobacterium violaceum: CV_2956
Entry
CV_2956           CDS       T00147                                 
Symbol
gntR
Name
(GenBank) transcriptional regulator GntR
  KO
K06145  LacI family transcriptional regulator, gluconate utilization system Gnt-I transcriptional repressor
Organism
cvi  Chromobacterium violaceum
Brite
KEGG Orthology (KO) [BR:cvi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cvi03000]
    CV_2956 (gntR)
Transcription factors [BR:cvi03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    CV_2956 (gntR)
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_31 HTH_23 TetR_N
Other DBs
NCBI-ProteinID: AAQ60624
LNCC_Brazil: CV2956
UniProt: Q7NTU7
Structure
Position
3236081..3237100
AA seq 339 aa
MSRKPRVRSGSGVTMHDVAKAAGVSAITVSRVLNQPQQVSEQLREKVMQAVDALAYVPSR
SASTLASAKSRTVLVLIPSLANTVFLETLTGIETVLDAAGYQMLIGNSHYDAGQELQLLR
AYLQHRPDGVLITGLSHAEPFERILSQHALPVVYMMDLADDGRCCVGFSQEDAGAAITRH
LLSRGKRRIGFLGAQLDERVMKRLDGYRAALDAADCRDAGLEWLDPQPSSMQMGADMLDR
ALAERPDCDALFCCNDDLAIGALARSQQLGIAVPERLAIAGFNDLQPAAWCTPPLTTVAT
PRRDIGVHAAKALLQLIDGEEPASRRADLGFRLMLRRSS
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgtccagaaaaccgcgcgtccgctccggcagcggcgtcaccatgcacgacgtggccaag
gcggccggcgtcagcgccatcaccgtgtcccgggtgctgaaccaaccccagcaggtgtcc
gagcagctgcgcgaaaaagtgatgcaagccgtggacgcgctggcctacgtgcccagccgc
tccgccagcacgctggcctcggccaagtcgcggacggtgctggtgctgatcccctcgctg
gccaacaccgtgttcctggaaacgctgaccggcatcgaaacggtgctggacgccgccggc
taccagatgctgatcggcaacagccattacgacgcaggccaggagctgcagttgctgcgc
gcctatctgcagcaccggccggatggcgtcctgatcaccggcctcagccacgcggagccg
ttcgaacgcatcctgagccagcacgcgctgccggtggtctacatgatggacctggccgac
gacggccgctgctgcgtggggttttcgcaggaggatgccggcgccgccatcacccgccac
ctgctgtcgcgcggcaagcgccgcatcggctttctcggcgcgcagctggacgagcgggtg
atgaagcgcctggacggctaccgcgcggcgctggacgcggccgactgccgcgacgccggg
ctggaatggctggacccgcagccgtccagcatgcagatgggcgcggacatgctggaccgc
gcgctggcggagcggccggactgcgacgcgctgttctgctgcaacgacgacctggcgatc
ggcgcgctggcgcgcagccagcagctgggcatcgccgtgccggagcggctggccatcgcc
ggcttcaacgacctgcagcccgccgcatggtgcaccccgcccctgaccacggtggccacg
ccgcggcgcgacatcggcgtccacgccgccaaagcgctgttgcagctgatagatggcgag
gagccggcgtcccgccgcgccgatctgggcttccggctgatgttgcgccgcagcagctga

DBGET integrated database retrieval system