KEGG   Chromobacterium violaceum: CV_0864Help
Entry
CV_0864           CDS       T00147                                 

Definition
(GenBank) probable haloacid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
cvi  Chromobacterium violaceum
Pathway
cvi00361  Chlorocyclohexane and chlorobenzene degradation
cvi00625  Chloroalkane and chloroalkene degradation
cvi01100  Metabolic pathways
cvi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cvi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CV_0864
   00361 Chlorocyclohexane and chlorobenzene degradation
    CV_0864
Enzymes [BR:cvi01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     CV_0864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AAQ58539
LNCC_Brazil: CV0864
UniProt: Q7NZQ7
Position
complement(893777..894496)
Genome map
AA seq 239 aa AA seqDB search
MSQPVQALLFDVFGTVVDWREGVARDAAAFLRRRPAARQDAYAFADAWRALYSPAMEAVR
AGRRPFTRLDQLHRENLEATLPAFGVDPASAPEDELQWLNRAWHRLDPWPDSVAGLARLK
AGHIIATLSNGNTSLLLNMAKYAGLPWDAILGAEAAQAYKPMPQAYLRTAELLDLPPERI
CLVAAHNGDLAAARRCGFKTAFIMRPREFGPEQRTDLAAEQDWDWVARDLVELAGILGC
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagcctgttcaggctctgctgttcgacgtattcggcacggtggtggattggcgc
gagggcgtggcacgcgacgccgccgcctttctgcggcgccggcccgcagccaggcaggac
gcttacgccttcgccgacgcctggcgagccctctactcgccggcaatggaagcggtgcgc
gccggccgccggccgttcacccggctggaccagctgcaccgcgaaaacctggaggccacg
ctgccggccttcggcgtcgatcccgcctcggcgccggaagacgagctgcaatggctgaac
cgcgcctggcaccggctggatccgtggccggacagcgtggcgggcctggcgcgactgaag
gcgggccatatcatcgccacgctcagcaacggcaacaccagcctgctgctgaatatggcc
aaatacgccggcctgccatgggacgcgatactcggcgccgaagcggcccaggcctacaag
ccgatgccgcaggcctatctgcgcaccgcggaactgctggacctgccgccggagcggatc
tgcctggtcgcggcccataacggcgatctggccgccgcgcgccgctgcggattcaaaacc
gccttcatcatgcgtccccgcgaattcggcccggagcagcggacggatctggcggcggaa
caggattgggattgggtggcgagggatttggtggagttggcgggaatacttgggtgctga

DBGET integrated database retrieval system