KEGG   Chromobacterium violaceum: CV_0926Help
Entry
CV_0926           CDS       T00147                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
cvi  Chromobacterium violaceum
Pathway
cvi00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:cvi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CV_0926
Enzymes [BR:cvi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     CV_0926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: AAQ58600
LNCC_Brazil: CV0926
UniProt: Q7NZJ6
Position
960524..961117
Genome map
AA seq 197 aa AA seqDB search
MFDQLVLASNNAGKLKEFGALFAELGVTVRPQRDFDVPECPEPHHTFLENALEKARHASR
LTGLPALADDSGICVEALGGAPGVFSARFAGEPKSDARNNALLVEKLQGEANRRAWYYCV
LVLVRHADDPQPLVADGIWLGEVRDEAAGEGGFGYDPHFHLPGYGVSVAELDAAEKNRVS
HRGQALAALMAKLKALA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatcaactggtcctcgccagcaacaacgccggcaagctgaaggaattcggcgcg
ttgttcgccgagctcggcgtcaccgtgcgcccgcagcgcgacttcgacgtgccggaatgt
ccggagccgcatcacaccttcctggaaaacgcgctggagaaagcgcgccatgccagccgg
ctgaccggcctgccggcgctggccgacgattccggcatctgcgtcgaggcgctgggcggc
gcgccgggcgtgttctccgcgcgcttcgccggcgaacccaagtccgacgcgcgcaacaac
gcgctgctggtggaaaagctgcagggcgaggccaaccgccgcgcctggtactactgcgtg
ctggtgctggtgcgccacgccgacgacccgcaaccgctggtggccgacggcatctggctg
ggcgaggtgcgcgacgaggccgcgggcgaaggcggcttcggctacgacccgcatttccat
ctgccgggctacggcgtatcggtggccgaactggacgccgccgaaaagaaccgcgtcagc
caccgcggccaggcgctggccgcgctgatggccaagctcaaggcgctggcatga

DBGET integrated database retrieval system