KEGG   Chromobacterium violaceum: CV_1653Help
Entry
CV_1653           CDS       T00147                                 

Gene name
hemG
Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
cvi  Chromobacterium violaceum
Pathway
cvi00860  Porphyrin and chlorophyll metabolism
cvi01100  Metabolic pathways
cvi01110  Biosynthesis of secondary metabolites
Module
cvi_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CV_1653 (hemG)
Enzymes [BR:cvi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CV_1653 (hemG)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     CV_1653 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase DAO NAD_binding_8 HI0933_like NAD_binding_9 Pyr_redox_2 FAD_binding_2 Pyr_redox Thi4 GIDA AlaDh_PNT_C Pyr_redox_3 3HCDH_N FAD_oxidored FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AAQ59329
LNCC_Brazil: CV1653
UniProt: Q7NXH3
Position
1791071..1792405
Genome map
AA seq 444 aa AA seqDB search
MESIFRETIMIAVIGAGVSGLSCAWWLQRHGMPVRVFEAAERVGGKVSTLAGEALCEQGP
NTLLLDEELGQWLAELGLSPLWPEQGSDLRHVLQRGRYRPLPAGPWQLMAGGLLSWRAKW
QLLRGLLRPGDPAEAESSLAAFCRRRFGQEVLDKLLDPLACGVFAGDPEELALDETLPRL
ARAAARPLPLWKGLWRERAGRARMCTLPGGLQQLPQRLARDLDIKLGAPVTALRRDGDGW
RLRTREGWEWADRVVLAVPAAAAAELLHPLAPEMADVCRRIPYAPLAVVSTLLDGEAMEK
PLPGYGALHPSGEGALTLGHLTVSNIYPHVCPDGTRLVTSFIGGRKHPEWLEQDDDALLA
GLNQELERLFGMRGRPLAQHLTRWPQALPQGTPLQRRLRGAAEQWGGRGLHLCVNWLDGA
SLPDCLRKGRRLARRLAEREGGFA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgatttttcgggagacgatcatgatcgcggtaatcggcgccggcgtttcaggg
ctgtcctgcgcctggtggctgcaacggcacggcatgccggtgcgggtgttcgaagcggcg
gaacgcgtcggcggcaaggtgagcaccttggcgggggaggcgctgtgcgagcaggggccc
aatacgctgctgctggacgaggaactggggcaatggctggcggagctcggcttgtcgccg
ctgtggcctgagcaagggagcgatttgcggcatgtgctgcagcgtgggcgctaccggccg
ttgcctgccggcccctggcaactgatggcgggcggcctgcttagctggcgggccaaatgg
cagctgttgcgcggactgttgcggccgggcgatccggccgaggccgagtcctcccttgcg
gctttctgccgccgccgtttcgggcaggaagtgctggacaagctgctggacccgctggcc
tgcggcgtgttcgccggggatccggaggaactggcgctggacgagacgctgcccaggctg
gcgcgggcggcggcgcggccgctgccattgtggaagggactgtggcgcgaaagggccggg
cgcgcccggatgtgcaccttgccaggcgggctgcagcaattgccgcagcggctggcgcgg
gatctggacatcaagctgggcgcgccggtgaccgcgctgcgccgcgacggcgacggctgg
cggctgcgtacccgcgagggttgggagtgggccgatcgggtggtgttggccgtgccggcc
gccgccgccgccgagctgctgcatccgctggcgccggaaatggccgacgtctgccggcgc
attccgtacgcgccgctggccgtggtgtccacgctgctggacggggaggcgatggagaag
ccgctgccaggctacggcgcgctgcatccgagcggggagggcgcgttgacgttgggccat
ctgacggtcagcaacatctatccgcacgtttgtcccgacggcacccggctggtgaccagc
ttcatcggcggccgcaagcatccggaatggctggaacaggacgacgacgcgctgctggcg
gggctcaaccaggagctggaacgcctgttcggcatgcgcggcaggccgctggcgcagcac
ctgacgcgttggccgcaggccttgccgcagggcacgccgctgcagcgccggctgcgcggc
gcggccgagcagtggggcggacggggcttgcatctgtgcgtcaactggctggatggcgca
tccctgccggattgcctgagaaaagggcggcggctggcccggcgattggcggagcgggaa
ggcggctttgcgtga

DBGET integrated database retrieval system