KEGG   Chromobacterium violaceum: CV_1965Help
Entry
CV_1965           CDS       T00147                                 

Definition
(GenBank) probable protease
  KO
K05998  pseudomonalisin [EC:3.4.21.100]
K05999  xanthomonalisin [EC:3.4.21.101]
Organism
cvi  Chromobacterium violaceum
Brite
KEGG Orthology (KO) [BR:cvi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cvi01002]
    CV_1965
Enzymes [BR:cvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.100  sedolisin
     CV_1965
    3.4.21.101  xanthomonalisin
     CV_1965
Peptidases and inhibitors [BR:cvi01002]
 Serine peptidases
  Family S53
   CV_1965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro-kuma_activ
Motif
Other DBs
NCBI-ProteinID: AAQ59637
LNCC_Brazil: CV1965
UniProt: Q7NWL8
Position
complement(2137863..2139542)
Genome map
AA seq 559 aa AA seqDB search
MQTHKTTLLMLGCLFNIPVQAAGWISTGTQAHPTQQLAPNARDAGEIAGGEVVRIAVSLA
MRNQASLNALTDNILAGQGQPISDAQFMSQYAPTAAQAQQVVSHLRQSGFRNIAVSPNNL
LVTAEGSAATVYGAFQTRLHRYDVGGRQAVANIQNAQVPASLAGIVLAVHGLQSVHQFHA
AFHAQSVSKAASGIVAHKPTDFASIYNAASLPAAKNGVAGIIAEGNLSQTVADLNSYAKS
AGFAAPSVAIVNAGTPSADTSGIMEWNLDSQTMLAASGGALKQLQFYVAPSMNNADIAAA
INAAVAANSAKVINVSLGECELGAKASGMTASVDQMLQAAVAHGQTFSVSSGDSGSYECG
GSSAYQSYPAVSPYVIAVGGTTLTTGGTTAYGSEKTWSGSGGGPSATEAAPSWQTASGVL
TTAKTKRGVPDIAFDADPGSGELVLVSGSTYQVGGTSLAAPLFSGFWIRIQSANGNKLTS
PANAIYKYFKANPSLYRDVASGSNGAFKATAGWDYTTGWGSLNIRQSQRLHRQDRRFLTE
AARKRPACTRGVCFGRAAA
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgcagacccataaaacgaccttgttgatgctcggttgcctgttcaacatcccggtccag
gccgccggttggataagcacaggcacccaggcgcatccaacccagcaattggctccaaac
gcgcgggatgccggagagatcgccggcggcgaggtcgtacgcatcgcggtcagcctggcg
atgcgcaatcaggcttcgctgaacgcgctcaccgacaacatcctggccgggcagggacag
cccatcagcgacgcgcagttcatgagccaatacgcgcccaccgcggcccaagcgcaacaa
gtggtgagccatctacggcaaagcggcttccgcaatatcgccgtctcccccaataacctg
ctggtcacggcggaaggcagcgccgccaccgtttacggcgccttccagacccggctgcac
cgatacgatgtgggcggcagacaagcggtcgccaacatccagaacgcccaggtgccggcc
agcctggccgggatcgtgctggcggtgcacggtctgcagagcgtccatcagttccatgcg
gccttccacgcccaaagcgtgagcaaggccgcctcgggcatcgtcgcccacaagccgacg
gacttcgcctcgatctacaacgccgccagccttcccgccgccaaaaacggcgtggccggc
atcatcgccgaaggcaatctgagccagacggtggccgatctgaacagttacgccaaaagc
gccggcttcgccgcgcccagcgtcgccatcgtcaacgccggcacgcccagcgccgacacc
tccggcatcatggagtggaatctggacagccagaccatgctggccgccagcggcggcgcg
ttgaagcagctgcagttctacgtcgcgccgtcgatgaacaacgccgacatcgccgcggcc
atcaatgcggcggtggcagccaacagcgccaaggtgatcaatgtgtcgctgggcgaatgc
gaactgggcgcgaaagcgtccggcatgaccgccagcgtcgaccagatgctgcaggccgcc
gtcgcccatggccagaccttttccgtctccagcggcgattccggctcctacgagtgcggc
ggcagtagcgcctatcaaagctatccggcggtttcaccctacgtgatcgcggtgggcggc
accacgctgaccaccggcggcacgaccgcctacggcagcgaaaagacctggagcggcagc
ggcggcggtcccagcgccacggaagccgccccatcctggcaaaccgcctccggcgtgctg
accacagccaagaccaagcgcggcgtgccggacatcgccttcgacgccgaccccggcagc
ggcgagctggtgctggtatccggcagcacttaccaggtaggcggcaccagcctggccgcg
ccgctgttcagcggcttctggatccgcatccaatccgccaatggcaacaagctgacttcg
ccggccaatgccatctacaaatacttcaaggccaatccttcgctgtaccgcgacgtggcc
agcggcagcaacggcgcgttcaaagccactgcgggatgggactacaccacaggctggggc
agcttgaacatccgccaatctcaacgccttcatcgccaagaccgccggtttctgacggaa
gccgcccgcaaacgccccgcgtgtacgcggggcgtttgctttggccgggccgccgcttag

DBGET integrated database retrieval system