KEGG   Chromobacterium violaceum: CV_2088Help
Entry
CV_2088           CDS       T00147                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cvi  Chromobacterium violaceum
Pathway
cvi00071  Fatty acid degradation
cvi00072  Synthesis and degradation of ketone bodies
cvi00280  Valine, leucine and isoleucine degradation
cvi00310  Lysine degradation
cvi00362  Benzoate degradation
cvi00380  Tryptophan metabolism
cvi00620  Pyruvate metabolism
cvi00630  Glyoxylate and dicarboxylate metabolism
cvi00640  Propanoate metabolism
cvi00650  Butanoate metabolism
cvi00900  Terpenoid backbone biosynthesis
cvi01100  Metabolic pathways
cvi01110  Biosynthesis of secondary metabolites
cvi01120  Microbial metabolism in diverse environments
cvi01130  Biosynthesis of antibiotics
cvi01200  Carbon metabolism
cvi01212  Fatty acid metabolism
cvi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CV_2088 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    CV_2088 (atoB)
   00640 Propanoate metabolism
    CV_2088 (atoB)
   00650 Butanoate metabolism
    CV_2088 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CV_2088 (atoB)
   00072 Synthesis and degradation of ketone bodies
    CV_2088 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CV_2088 (atoB)
   00310 Lysine degradation
    CV_2088 (atoB)
   00380 Tryptophan metabolism
    CV_2088 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CV_2088 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CV_2088 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CV_2088 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cvi04147]
    CV_2088 (atoB)
Enzymes [BR:cvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CV_2088 (atoB)
Exosome [BR:cvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CV_2088 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AAQ59760
LNCC_Brazil: CV2088
UniProt: Q7NWA2
Position
2273901..2275085
Genome map
AA seq 394 aa AA seqDB search
MQQQEIVIVGMARTAMGGFQGALSGLTASQLGAAAIRAAVERAGVSAGDVDEVIMGCVLP
AGQGQAPARQAALGGGLPQSTPCTTINKMCGSGMKALMMAHDQLLAGNGGVVVAGGMESM
SNAPYLMPKARGGLRLGHGEIKDHMFLDGLEDAYQKGTLMGVFAEQCAEKYGFSRQDQDE
FAIASLTRAQQAIKGGQFKDEIAAVTVPGRGGDTVVDTDEQPLKANLDKIPTLKPAFKKD
GTVTPANSSSISDGGAALVLMTAAEAAKRGLKPIARVVGHSSFAHEPGWFTTAPVHAIEK
LLAKTGWRAGEVDLYEINEAFAVVTMAAMHDLKLPHDKVNVHGGACALGHPIGASGARIV
ISLLSALKQRGGKRGVASLCIGGGEATALAVELI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaacaggaaatcgtgatcgtgggcatggcgcgcaccgccatgggcggcttccag
ggcgcgctgtccggtctgaccgccagccagctgggcgcggccgcgatccgcgccgcggtg
gagcgcgcaggcgtctccgccggcgatgtggacgaagtgatcatgggctgcgtgctgccg
gccggccagggccaggccccggcgcgccaggcggccctgggcggtggcttgccgcagtcc
acgccgtgcaccaccatcaacaagatgtgcggctccggcatgaaggcgctgatgatggcg
catgaccaattgctggccggcaacggcggcgttgtggtggccggcggcatggagagcatg
agcaacgcgccctatctgatgcccaaggcccgcggcggcctgcgcctgggtcatggcgaa
atcaaggaccacatgttcctggacggcctggaggatgcttatcagaagggcacgctgatg
ggggtgttcgccgagcagtgcgccgagaaatacggcttcagccgccaggaccaggatgag
ttcgccatcgcctcgctgacccgcgcccagcaggcgatcaagggcggccagttcaaggac
gagatcgccgctgtcacggtgccgggccgcggcggcgacacggtggtggacaccgacgag
cagccgctgaaggccaatctggacaagatcccgaccttgaagccggcattcaagaaggac
ggcaccgtgaccccggccaactccagctccatctccgacggcggcgccgcgctggtgttg
atgacggcggccgaggcggccaaacgcggcctgaagcccatcgcccgcgtggtcggccac
agcagcttcgcccacgagccgggctggttcaccaccgccccggtgcacgccattgaaaag
ctgctggccaagaccggctggagggccggcgaggtcgatctgtacgagatcaacgaagcc
ttcgccgtggtgacgatggcggcgatgcacgacctgaagctgccgcacgacaaggtgaac
gtgcatggcggcgcttgcgcgctgggccatccgatcggcgcgtccggcgcccgcatcgtg
atctcgctgctgtccgcgctgaaacagcgcggcggcaagcgcggcgtggccagcctgtgc
ataggcggcggcgaagccaccgcgctggcggtcgagctgatctaa

DBGET integrated database retrieval system