KEGG   Chromobacterium violaceum: CV_2183Help
Entry
CV_2183           CDS       T00147                                 

Gene name
apaG
Definition
(GenBank) apaG protein
  KO
K06195  ApaG protein
Organism
cvi  Chromobacterium violaceum
Brite
KEGG Orthology (KO) [BR:cvi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CV_2183 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 YidC_periplas
Motif
Other DBs
NCBI-ProteinID: AAQ59856
LNCC_Brazil: CV2183
UniProt: Q7NW07
Position
2355427..2355807
Genome map
AA seq 126 aa AA seqDB search
MADKLYQMEVQAEPQYVAEQSSVANDVYVFAYRVRITNTGSEPAQLISRHWIITDANQQV
QEVRGMGVVGEQPHLDPGQVFEYSSAAHITTPYGSMKGAYQMMADDGRRFEASIPEMTLV
APRVLH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggccgataaactctaccagatggaggtgcaggcggagccacaatacgtggccgaacag
tccagcgtcgccaacgacgtctacgtgttcgcctaccgcgtccgcatcaccaataccggc
agcgagccggcgcagctgatcagccgccactggatcatcaccgacgccaatcagcaggtg
caggaggtgcgcggcatgggcgtggtgggcgagcagccgcatctcgacccgggccaggtg
ttcgagtactccagcgcggcccacatcaccacgccgtacggcagcatgaagggcgcctac
cagatgatggcggacgacggtcggcgcttcgaggcgtccattcccgagatgacgctggtg
gcgccccgggtgctgcactaa

DBGET integrated database retrieval system