KEGG   Chromobacterium violaceum: CV_2300
Entry
CV_2300           CDS       T00147                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cvi  Chromobacterium violaceum
SSDB
Motif
Pfam: 4HBT 4HBT_3
Other DBs
NCBI-ProteinID: AAQ59972
LNCC_Brazil: CV2300
UniProt: Q7NVP2
Structure
PDB: 
4RMM

Position
2488462..2488902
AA seq 146 aa
MSEFMQRFADLRDRKAYAEIVDALPYVKLMGTSMAEDEQGELRFELPFLQRNVGNTTLPA
LHGGLIGGFMESAAMIHLMWNRESLEAPKIVDFSLDYLRPGRPQTLFAQCEITKQGKRVA
HVLIEAWQDDRSKPVAVARAHFLLTN
NT seq 441 nt   +upstreamnt  +downstreamnt
atgagcgaattcatgcaacgcttcgccgacttgcgcgatcgcaaggcctatgccgagatc
gtggacgcgctgccctacgtcaagctgatgggcacctcgatggcagaggacgagcagggc
gaactgcgcttcgaactgccgttcctccagcggaacgtcggcaacaccacgctgccggcg
ctgcacggcggcctgatcggcggcttcatggaaagcgcggcgatgatacacctgatgtgg
aatcgcgaatcgctggaggcgccgaagatcgtcgacttctcgctggattacctgcgtccc
ggccggccgcagacgctgttcgcccaatgcgaaatcaccaaacagggcaagcgggtggcg
catgtgctgatcgaggcctggcaggacgaccgctccaagccggtggcggtggcgcgagcc
catttcctgctgaccaattga

DBGET integrated database retrieval system