KEGG   Chromobacterium violaceum: CV_2346Help
Entry
CV_2346           CDS       T00147                                 

Definition
(GenBank) probable pseudouridylate synthases
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
cvi  Chromobacterium violaceum
Brite
KEGG Orthology (KO) [BR:cvi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cvi03016]
    CV_2346
Enzymes [BR:cvi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     CV_2346
Transfer RNA biogenesis [BR:cvi03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    CV_2346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AAQ60018
LNCC_Brazil: CV2346
UniProt: Q7NVJ6
Position
complement(2530831..2531580)
Genome map
AA seq 249 aa AA seqDB search
MLQILYRDDLLIAIHKPSNLLVHRTELDRHETRFAIQMLRDQIGRRVYPVHRLDKGTSGA
LLFALDKDAGRELSLQFERQQVYKRYLAVVRGHPDDAGHIDHPLSRRPDDLEWIGEKVET
APQPAVTDYRTLARVELPIMVERYPTSRYSLLELEPQTGRKHQLRRHLKHIAHPIIGDST
HGKGRHNRMFADQLGCRRMLLACVEMRLTHPITGQPLLLNCPLESNFSALLARLGWTDAA
RDAGIELTI
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaaatactgtatcgagacgatctgctgatcgccatccacaagccgtccaacctg
ctggtgcaccgcaccgagctggaccgccacgaaacccgtttcgccatccagatgctgcgc
gaccagatcggccggcgcgtctatccggtgcaccggctggacaagggcacctcgggcgca
ttgctgttcgcgctggacaaggacgccggccgcgaattgtccttgcagttcgaacgccag
caggtgtacaagcgctacctcgccgtggtccgcggccaccccgacgacgcgggccatatc
gaccatccgctcagccgccgcccggacgacctggaatggataggcgagaaagtggaaacc
gcgccgcagccggccgtcaccgattaccggacgctggcgcgcgtagagttgcccatcatg
gtggaacgctatcccaccagccgctacagcctgctggagctggaaccgcagaccggccgc
aagcaccaattgcgccgccatctgaaacacatcgcccaccccatcatcggcgactccacc
catggcaagggccgccacaaccggatgttcgcagaccagctgggctgccggcgcatgctg
ctggcctgcgtggaaatgcggctgacccaccccattaccggccagcccctgctgctgaac
tgcccgctggagagcaacttctccgcgctgctggcgcgcctgggctggaccgacgccgcg
cgcgatgccggaatcgaattaaccatctga

DBGET integrated database retrieval system