KEGG   Chromobacterium violaceum: CV_2389Help
Entry
CV_2389           CDS       T00147                                 

Gene name
ribAB
Definition
(GenBank) riboflavin biosynthesis bifunctional protein : GTP cyclohydrolase ii and 3,4-dihydroxy-2-butanone-4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
cvi  Chromobacterium violaceum
Pathway
cvi00740  Riboflavin metabolism
cvi00790  Folate biosynthesis
cvi01100  Metabolic pathways
cvi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cvi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CV_2389 (ribAB)
   00790 Folate biosynthesis
    CV_2389 (ribAB)
Enzymes [BR:cvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     CV_2389 (ribAB)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     CV_2389 (ribAB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AAQ60061
LNCC_Brazil: CV2389
UniProt: Q7NVF4
Position
2570968..2572092
Genome map
AA seq 374 aa AA seqDB search
MTISPIQDIIADIQAGKMVVLMDAEDRENEGDLVMAAEFVTPEAINFMAKYGRGLICLTL
TEERCKLLNLPMMATNNGTSFGTNFTVSVEAAEGVTTGISAADRAHTIKTAVARLAKASD
LVQPGHVFPLKAQNGGVLIRAGHTEAGCDLAMLAGVEPAGVICEIMNDDGTMARLPELLE
FAKQHGLKIGTISDLIQHRSRTESLVEKVGERPVETPFGSFDLHVFRDITTSATHLALSK
GKIRPDKEILVRVHEPLSVIDVLAPLCSHHSWTLPNALETMEEEGCGVMVLLYRDETGAD
LAQRALDQEPPRQKWDSKTFGIGAQMLKALGVGKMKLMSSPVSLPSMAGFELEVTGFCQP
GHFHVDRDGGPGVA
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaccatatctccgatccaagacatcatcgccgacatccaggccggcaagatggtggtg
ctgatggacgccgaagaccgcgagaacgaaggcgacctggtgatggcggccgagttcgtc
acgccggaagcgatcaacttcatggccaaatacggccgcggcctgatctgcctgacactg
accgaagagcgctgcaagctgttgaacctccctatgatggcgaccaacaacggcaccagt
ttcggcaccaatttcaccgtgtcggtggaagcggccgagggcgtcaccaccggcatttcc
gccgccgaccgcgcccacaccatcaagaccgccgtcgcgcggctggccaaggccagcgac
ctggtccagcccggccacgtgttcccgctgaaggcgcagaacggtggcgtgttgatccgc
gccggccataccgaggccggctgcgacctggcgatgctggcgggcgtggagccggccggc
gtgatctgcgagatcatgaacgacgacggcaccatggcgcgcttgccggagctgctggag
ttcgccaagcagcacggactgaagataggcaccatctccgatctgatccagcaccgcagc
cgcaccgaatccctggtggagaaagtgggcgagcgtccggtggagaccccgttcggcagc
ttcgacctgcacgtgttccgcgacatcaccacctccgcgacccatctggcgctgagcaag
ggcaagatacgccccgacaaggaaatcctggtgcgggtgcatgagccgctgtcggtgata
gacgtgctggcgccgctgtgcagccaccactcctggacgctgcccaacgcgctggaaacc
atggaggaagagggctgcggcgtgatggtgctgctgtaccgcgacgagaccggcgccgat
ctggcgcagcgcgcgctggaccaggagccgccgcggcagaaatgggacagcaagaccttc
ggcatcggcgcccagatgctgaaggcgctgggcgtgggcaagatgaagctgatgtccagc
ccggtgagcctgccgtcgatggccggcttcgagctcgaagtgaccggattctgccagccc
gggcacttccacgtggaccgggacggcggtccgggcgtggcctaa

DBGET integrated database retrieval system