KEGG   Chromobacterium violaceum: CV_3523Help
Entry
CV_3523           CDS       T00147                                 

Definition
(GenBank) probable ribonuclease R
  KO
K12573  ribonuclease R [EC:3.1.13.1]
Organism
cvi  Chromobacterium violaceum
Pathway
cvi03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:cvi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    CV_3523
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cvi03019]
    CV_3523
   03016 Transfer RNA biogenesis [BR:cvi03016]
    CV_3523
Enzymes [BR:cvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     CV_3523
Messenger RNA biogenesis [BR:cvi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     CV_3523
Transfer RNA biogenesis [BR:cvi03016]
 Prokaryotic Type
  tRNA degradation factors
   CV_3523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB CSD2 OB_RNB S1 HTH_12 Sucrose_synth
Motif
Other DBs
NCBI-ProteinID: AAQ61185
LNCC_Brazil: CV3523
UniProt: Q7NSA3
Position
complement(3825895..3828762)
Genome map
AA seq 955 aa AA seqDB search
MAQTSKKQKNSSLREQDPFLDREKLKYSNPLPSREFIMQILAEQGVPLFPDELAHMLSIR
RDEHAFFERRLRAMERDGEIIINRKGAVCVAQKLDLIRCKVSGHRDGYGFAMPDEGEGTG
TDIFLPEREMKKVMHGDRVMVRPSGVDRRGRQEGKIVEVLEHAVSKLVGRIQHERGVWVV
RPEDRRINHDILVEPGGDAGAKDGQVVMVDILQQPDAYHQPVGRVAEVLGNYADPGMEIE
IALRKHALPHRFPDDALAQAKATPKKVRKKDWTKDRVDLRDLPLVTIDGETARDFDDAVY
AEKLGKGYRLVVAIADVSFYVQPGDALDKEALDRGTSVYFPRRVIPMLPEALSNGICSLN
PDVERMCMVCDMQINAKGEVKKYKFYPAVMQSKARLTYNQVWDWLQNGTDHPMLPHVKDL
YALFKILLAARSKRGAIEFDSVETQMIFNDQGKIERIVPIVRNDAHRLIEECMLAANVCS
ADFLQKNGHKALYRVHEGPTEEKLENLRTYLRLVGLTLGGGDKPTAKDYGKLAEQIHGRP
DAPVLQTMLLRSMQQAVYTPDNNGHFGLAYEAYTHFTSPIRRYPDLLVHRAIKAVLKGVK
YKPGKWAQLGVHCSMTERRADDASRDVESWLKTYYMRDKVGEVFQGKISAVTSFGVFVLL
DDVYAEGLVHISELGKDYFHFKKDVQAIIGEKSGIQYRLGDALTVKVMGANLESSQVDFA
LVRDEPSAQAVVGAGAGAGVERAAPAKAGRRRRGKAGGAGDARAQPSEAIPAPDAVKAEP
AMSKPAGLPPAPKGRSHPTKPVTEQKPVAKTQTRQVAKPAEVRESAKKPDSRSGAAAQAP
ASAAKPVAAKGRSTSAKPTAEAKPASQPVVAQPAATKPVPASGDATAPAAGTARGRSARR
GRQDAAATQAPEAKQAAARGQAAKPPAVAPQAEPKARPQAASRKRGSAKRGADEA
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaacctcaaaaaagcaaaaaaactcttccctccgcgaacaggatccgttcctc
gacagggaaaaactcaaatattccaatcccttgcccagccgcgagttcatcatgcagatt
ctcgccgagcagggggtgccgctgtttccggacgaattggcccatatgctgtcgattcgc
cgcgacgagcatgccttctttgaacgccggctgcgcgcgatggagcgcgacggcgaaatc
atcatcaaccgcaagggcgcggtctgcgtcgcccagaagttggatctgatccgctgcaag
gtgtccggccatcgcgacggctacggtttcgccatgcccgacgagggagaaggcaccggc
accgacatcttcctccccgaacgggagatgaagaaagtgatgcacggcgaccgcgtgatg
gtgcggccgtccggcgtcgaccgccgcggcaggcaggaaggcaagatcgtcgaggtgctg
gagcacgcggtgagtaagctggtcggccgcatccagcacgagcgcggcgtgtgggtggtg
cggccggaagaccgccgcatcaaccacgacattttggtcgaaccgggcggcgacgcgggc
gccaaggacggccaggtggtgatggtggacatcctgcagcagccggatgcctaccaccag
cctgtcggcagggtggccgaagtgctgggcaactatgccgatccgggcatggagatcgaa
atcgcgctgcgcaagcacgcgctgccgcatcgctttccggacgatgccctggcccaggcc
aaggcgacgccgaagaaagtgcgcaagaaggattggaccaaggaccgcgtcgacctgcgc
gatttgccgctggtgacgatagacggcgagaccgcgcgcgacttcgacgacgcggtgtac
gccgaaaagctgggcaagggttaccgtctggtggtggcgatcgccgacgtcagcttctac
gtgcagccgggcgacgcgctggacaaggaagcgctggaccgcggcacctcggtttatttc
ccgcgccgggtgatcccgatgctgccggaggcgctgtccaacggcatctgttcgctgaat
cccgacgtcgagcgcatgtgcatggtctgcgacatgcagatcaacgccaagggcgaggtc
aagaagtataagttctatcccgcggtgatgcagtccaaagcccgcctcacctacaaccag
gtgtgggactggctgcagaacggcaccgatcatccgatgctgccgcatgtgaaggacttg
tacgctttgttcaagatcctgctggccgcgcgctccaagcgcggcgccatcgagttcgac
tcggtggagacgcagatgatcttcaacgatcagggcaagatcgagcgcatcgtccccatc
gtgcgcaacgacgcgcatcggctgatcgaggagtgcatgctggcggccaacgtctgctcg
gccgattttctgcagaaaaacggccacaaggcgctgtaccgcgtccatgaagggccgacc
gaggaaaagctggaaaacctgcgcacctatctgcggctggtcggcctgacgctgggcggc
ggcgacaagcccaccgccaaggattacggcaagctggcggagcagatccacggccgcccg
gacgcgccggtgctgcagaccatgttgctgcgctcgatgcagcaggcggtctacacgccg
gacaacaacggccatttcggcttggcttacgaggcttacacccatttcacctcgcccatc
cgccgctacccggacctgctggtccatcgcgcgatcaaggcggtgctcaagggcgtcaag
tacaagcccggcaagtgggcgcagctgggcgtgcattgctcgatgaccgagcgccgcgcc
gacgacgccagccgcgatgtcgagtcctggctgaaaacctattacatgcgcgacaaggta
ggcgaggtcttccaaggcaagatcagcgcggtcaccagcttcggcgtgttcgtgttgctg
gacgatgtctacgccgagggcctggtgcacatctccgaactgggcaaggactacttccat
ttcaagaaggacgttcaggccatcatcggcgagaagagcggcatccagtaccgtctgggt
gatgcgctgaccgtcaaggtgatgggcgccaatctggaaagctcccaggtcgatttcgcc
ctggtcagggacgagccatccgcccaggcggtggtgggagcgggagcgggagcgggagtg
gagcgggctgcgccagccaaggcgggacgccgtcgccgcggcaaggccggcggcgcgggc
gatgcgcgcgcgcagccgagcgaggccattccagctcctgatgcggtgaaggcggagccg
gctatgagcaagccggccggtttgccgccggcgccgaaggggcgcagccacccgaccaaa
ccggtgaccgagcaaaagcctgtcgccaagacgcagacgcggcaagtggccaagccggct
gaggtgcgggagtccgcgaagaagcccgactcaaggtccggcgccgcggcgcaagcgcct
gccagcgcggccaagcctgtcgctgccaaggggcggagcacatcggcgaagcccacggcc
gaggcaaagccggcgagccagcccgtggtcgctcagcctgcggccaccaagcccgttccg
gcatccggggacgcgaccgcgcctgccgcgggtacggcgcgcggccgttcggccaggcga
ggccggcaggacgcggctgcgacgcaggcacccgaggcgaagcaagctgctgcccgcgga
caagcggccaagccaccggccgtcgctcctcaggcggaacccaaggctcggccgcaagcc
gcgagccgcaagcgcggcagtgctaagcggggggctgacgaagcctga

DBGET integrated database retrieval system