KEGG   Chromobacterium violaceum: CV_3787Help
Entry
CV_3787           CDS       T00147                                 

Definition
(GenBank) probable glutathione peroxidase protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cvi  Chromobacterium violaceum
Pathway
cvi00480  Glutathione metabolism
cvi00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CV_3787
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CV_3787
Enzymes [BR:cvi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CV_3787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AAQ61449
LNCC_Brazil: CV3787
UniProt: Q7NRJ4
Position
complement(4083876..4084355)
Genome map
AA seq 159 aa AA seqDB search
MTTLYDFSAQRADGAEQALSAYEGRVALLVNTASECGYTRQYAGLQELQDYFAGQAFVVL
GFPCNQFGGQEPGGEDEIVDFCRSRFGVSFPLFAKLQVNGDGAHPLWRWLTQADSDRPHP
IKWNFTKFLVDGRGRVVKRYEPAVEPHELVDDIKALLAR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgctctacgattttagcgcgcagcgggccgacggcgccgaacaggcgctctcg
gcctatgagggcagggtggccttgctggtgaacaccgccagcgagtgcggctatacccgg
caatacgcgggactgcaggaattgcaggactatttcgccggccaggctttcgtcgtgctc
ggttttccctgcaaccagttcggcggccaggagccgggtggcgaggacgagatcgtcgat
ttctgccgcagccgtttcggcgtgtccttcccgctgttcgccaagctgcaggtgaacgga
gacggcgcgcatcccttgtggcgctggttgacccaggccgattcagaccgtccgcatccg
atcaagtggaacttcaccaagttcctggtcgatggccgcggccgggtggtgaagcgctac
gagccggcggtggagccgcacgagctggtagacgacatcaaggcgctgctggcgaggtga

DBGET integrated database retrieval system