KEGG   Chromobacterium violaceum: CV_3965
Entry
CV_3965           CDS       T00147                                 

Definition
(GenBank) probable ClpA/B-type chaperone
  KO
K11907  type VI secretion system protein VasG
Organism
cvi  Chromobacterium violaceum
Pathway
cvi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cvi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    CV_3965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cvi02044]
    CV_3965
Secretion system [BR:cvi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   CV_3965
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 ClpB_D2-small Clp_N AAA_22 AAA_16 AAA_7 TniB Sigma54_activat AAA_18 Zeta_toxin TIP49 AAA_25 IstB_IS21 AAA_23 ResIII NTPase_1 AAA_29 AAA_14 AAA_24 DUF812 NACHT RuvB_N T2SSE SRP54 Hpr_kinase_C AAA_PrkA
Other DBs
NCBI-ProteinID: AAQ61627
LNCC_Brazil: CV3965
UniProt: Q7NR20
Position
complement(4286490..4289117)
AA seq 875 aa
MKSLIDRLTPTARQAIEQAASRALARTHFEIEIEHVLLAMFDQDDNAALAALRALGADLG
RVERELDAALDNFRSGNTRNPVLSSWLPKWLEKAWLLASAEHGQDSVSTLDLLLALWQDD
ALRGALQSGAPALARQDAGRLSGAYAALRQHGGEAAGGEQPSAAADEGEGEAPAAPQGKR
GGAALDKYTIDLTAQAKAGKIDPILGRDVEIRQMIDILMRRRQNNPILTGEPGVGKTAVV
EGLARKIVLGEVPPVLSGVTLRTLDLGLLQAGASVKGEFENRLRQVIDEVKASPVPIILF
IDEAHTLIGAGGAAGQNDAANLLKPALARGELRTIAATTWAEYKKYFEKDAALARRFQVV
KVEEPAPEIAVQMVRGLTDAMAKHHKVEILNEAVAAAVQLSSRYIAGRQLPDKAISVLDT
ACARVALSRAGKPGPIEDVTVLIDNIDRETAALEREEGHAERIAELQAQRAKLEQDLAAL
HQAWEAQQKLIEEIDELKAAKDEAKPAKGRKLSPLQAKRKELRELQKHQPLAFECVDESV
IADVIAGWTGIPLGRMVSNELEQVQKLAKLLAERVIGQDHALEQIAERVQIAKANLEDPG
KPKGVFLLVGPSGVGKTETALALAEALYGGERNLITINMSEYQEAHSVSGLKGSPPGYVG
YGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVLELFFQVFDKGVLEDSEGREVDFKNTIIL
LTSNAGTDLVMRACEHGVTVEDETRDPTAEDLVEILRPTLQKTFKPAFLGRLTIVPYFPI
SDDVLRAIVGLKLDKIRRRIADNHGAQVEFPEELADQMAARCLDVDSGARNADAILTRTL
LAQISNDLLSRMASGKPVKKIAVALKGEQVKVKVS
NT seq 2628 nt   +upstreamnt  +downstreamnt
ctgaaatccctgatagaccggttgacgcccaccgcgcgccaggccatcgagcaggccgcc
agccgcgcgctggcccgcacccacttcgagatcgagatcgagcatgtgctgctggcgatg
ttcgatcaggacgacaatgccgcgctggcggcgctgcgcgcgctgggcgcggacctgggc
cgcgtcgagcgcgagctggacgccgcgctggacaacttccgcagcggcaatacccgcaat
ccggtgctgtcgtcgtggctgcccaagtggctggaaaaggcctggctgctggccagcgcc
gagcacggccaggacagtgtctccacgttggacttgctgctggcgctgtggcaggacgac
gccctgcgcggcgcgctgcagtccggcgcgccggcattggcgcgccaggatgccggcagg
ctgtccggcgcctacgccgcgctgcgccagcacggcggcgaggcggcgggcggcgagcag
ccgtcggccgcggcagacgagggcgaaggcgaggcgccggccgcgccgcagggcaagcgc
ggcggcgccgcgctggacaagtacacgatagacctgaccgcgcaggccaaggccggcaag
atcgaccccatcctgggccgcgatgtcgaaatccgccagatgatagacatcctgatgcgc
cgccggcagaacaatcccatcctcaccggcgagccgggcgtgggcaagaccgcggtggtg
gaaggcttggcgcgcaagatcgtgctgggcgaggtgccgccggtgctgtccggcgtcacg
ctgcgcacgctggacctgggcctgctgcaggccggcgccagcgtcaagggcgagttcgag
aaccgcctgcgccaggtgatagacgaggtcaaggccagcccggtgcccatcatcctgttc
atcgacgaggcgcacaccctgatcggcgccggcggcgcggccggccagaacgacgcggcc
aacctgctgaaaccggcgctggcgcgcggcgagctgcgcaccatcgcggcgacgacctgg
gccgagtacaagaagtatttcgagaaggacgccgcgctggcgcgccgcttccaggtggtg
aaggtcgaagagccggcgccggaaatcgccgtgcagatggtgcgcggcctgaccgacgcg
atggccaagcaccacaaggtggaaatcctcaacgaggcggtggccgccgcagtgcagctg
tccagccgctacatcgccggccgccagctgccggacaaggcgatcagcgtgctcgacacc
gcttgcgcccgcgtcgcgctgtcgcgcgccggcaagccggggccgatcgaggacgtgacg
gtgctgatagacaacatcgaccgcgaaaccgccgcgctggagcgcgaggaaggccacgcc
gagcgcatcgccgagctgcaggcgcagcgcgccaagctggagcaggatctggccgcgctg
catcaggcctgggaggcgcagcagaagctgatcgaagagatagacgagctgaaggcggcc
aaggacgaggccaagccggccaagggcaggaagctcagcccgctgcaggccaagcgcaag
gaattgcgcgagttgcagaagcatcagccgctggcgttcgaatgcgtggacgagagcgtg
atcgccgacgtgatcgccggctggaccggcatcccgctgggccgcatggtcagcaacgag
ctggagcaggtgcagaagctggccaagctgctggccgagcgcgtgatcggccaggaccac
gcgttggagcagatcgccgagcgggtgcagatcgccaaggccaatctggaagatcccggc
aagcccaagggcgtattcctgctggtgggcccgtccggcgtcggcaagaccgagaccgcg
ctggcgctggccgaggcgctgtacggcggcgagcgcaatctgatcaccatcaacatgtcc
gaataccaggaagcgcacagcgtgtccggcctgaagggctcgcccccgggttatgtcggc
tacggcgagggcggcgtgctgaccgaggcggtgcgccgcaagccgtactccgtcgtgctg
ctggatgaagtggagaaggcgcacccggacgtgctggagctgttctttcaggtattcgac
aagggcgtgctggaggatagcgaaggccgcgaggtggacttcaagaacaccatcatcctg
ctgacgtccaacgccggcaccgatctggtgatgcgcgcctgcgagcacggcgtgacggtg
gaggacgagacccgcgacccgaccgcggaagacctggtggaaatcctgcgcccgacgctg
cagaagaccttcaagccggctttcctcggccgcctgaccatcgtgccttacttcccgatc
agcgacgacgtgctgcgcgccatcgtcggcctgaagctggacaagatccgccgccgcatc
gccgacaaccacggcgcccaggtcgagttcccggaagaactggccgatcagatggccgcg
cgctgcctggacgtggacagcggcgcgcgcaacgccgacgccatcctcacccgcacgctg
ctggcgcagatctccaacgacctgctgtcgcgtatggccagcggcaaaccggtgaagaag
atcgccgtcgcgctgaagggcgagcaggtcaaggtgaaggtgagttaa

DBGET integrated database retrieval system