KEGG   Chromobacterium violaceum: CV_3979
Entry
CV_3979           CDS       T00147                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
cvi  Chromobacterium violaceum
Brite
KEGG Orthology (KO) [BR:cvi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cvi02044]
    CV_3979
Secretion system [BR:cvi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   CV_3979
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AAQ61641
LNCC_Brazil: CV3979
UniProt: Q7NR06
Position
complement(4303153..4303659)
AA seq 168 aa
MGKESTQKKLSRVRPPRVQITYDVEIGDAIETKELPFVLGVLGDYSGHSKEPLPKMKERK
FVQIDRDNFDEVLKGMAPRLAMKVDNALKDDGTQLGVELNFESLSDFEPQNVVRQIDPLN
QLLEARTRLADLRNKLAGNDKLEELLDEVVRDTEKLRQIGGKKEGGEQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgggcaaggaaagcactcagaaaaaactgtcgagggtccgtccgccgcgcgtgcagatc
acctatgacgtcgagatcggcgacgcgatcgaaaccaaggagctgccgttcgtgctgggc
gtgctgggcgattattccggccacagcaaggagccgctgccgaagatgaaggagcgcaag
ttcgtccagatcgaccgcgacaacttcgacgaggtgctgaagggcatggcgccgcgcctg
gcgatgaaggtggacaacgcgctgaaggacgacggcacccagctgggcgtggaattgaat
ttcgagagcctgtcggatttcgagccgcagaacgtggttcgccagatcgacccgttgaac
cagctgctggaggcccgcacccgcctggccgatctgcgcaataagctggccggcaacgac
aagctcgaagagctgctggacgaagtggtgcgcgataccgagaagctgcgccagatcggc
ggcaagaaagaaggaggcgagcagtga

DBGET integrated database retrieval system