KEGG   Chromobacterium violaceum: CV_3985
Entry
CV_3985           CDS       T00147                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11897  type VI secretion system protein ImpF
Organism
cvi  Chromobacterium violaceum
Brite
KEGG Orthology (KO) [BR:cvi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cvi02044]
    CV_3985
Secretion system [BR:cvi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   CV_3985
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: AAQ61647
LNCC_Brazil: CV3985
UniProt: Q7NR00
Position
4312201..4312680
AA seq 159 aa
MSVARHTQILPSVLDRLLDDEPDQSHIESISLFELPQFKRALARDLEALLNTRLMPLDEL
MESFPQARDSLLTFGIPDLSGISLLNPDDRELLREQLRRSIELHEPRLSRVRVNLDAPRE
MERHLRFRVDAVLKVHPHRPPVTFDATLQLSSNVYKVQG
NT seq 480 nt   +upstreamnt  +downstreamnt
atgagcgtcgcccgccacacccagatactgccctcggtgctggatcggttgctggacgac
gagccggaccagagccacatcgagtcgatcagcctgtttgaactgccccagttcaagcgg
gcgctggcgcgcgacctggaagcgctgctcaacacccggctgatgccgctggacgagttg
atggagtccttcccccaggcgcgcgacagcctgctcacgttcggcatcccggacctgtcc
ggcatcagcctgctcaacccggacgaccgagagctgttgcgcgaacagctgcgccgctcg
atcgagctgcatgagccgcggctgtcgcgcgtgcgcgtcaatctcgacgccccgcgcgag
atggagcgccacctgcgcttccgcgtcgacgcggtgctcaaggttcacccgcaccgcccg
ccggtgactttcgacgccacgctgcaactctcttccaacgtttacaaggtgcagggctaa

DBGET integrated database retrieval system