KEGG   Campylobacter volucris: CVOL_0905Help
Entry
CVOL_0905         CDS       T03558                                 

Definition
(GenBank) inorganic phosphate transporter, PitA family
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cvo  Campylobacter volucris
Brite
KEGG Orthology (KO) [BR:cvo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CVOL_0905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 RTX_C 7TM_GPCR_Sra
Motif
Other DBs
NCBI-ProteinID: AJC94211
Position
complement(872499..874022)
Genome map
AA seq 507 aa AA seqDB search
MNKDNMIAFFIFIISVLCFFVWGYNYIPNNSMILFILASVFGIFMAFNIGGNDVANSFGT
SVGAKTVTIKQALIIAAVFELSGAIFAGGSVTNTIRSGIVVLPNGVDPMVFVCIMLSALL
SSGIWLLIASKKGLPVSTTHSIIGGIVGASIAMGFMFFNQHEAFSMVNWNGIYKIVASWI
ISPLLGGLVAYLIYSYIYKRILEPSSLINVKIKEIKKEKKAFKEEYFKNLQNKSQEEQIK
ELSAIVLDDDEKKSEYKLKIKQLKDKEKDIDVFSKMKFHVPLIAGVAALVISSMFLFKGL
NKVSTLNLMQNLWIVFIISIFAYIVTLAVVRLMKKTELNKTIEKIFSWFQIFTASSFAFS
HGANDIANALGPFAAILDVLKNNTINPSSPVPFAVMLMFGISLVIGLWFLGKEVIQTVGS
KLAQIKPTTGFSAELGASIVILLATQLGIPVSSTHILIGAILGIGVFNKDAKWNMMKPIG
LAWVITLPVAGILSSIIFMIFVQILIL
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
ttgaataaggacaatatgatagcgttttttatttttataattagcgttttatgttttttt
gtttgggggtataattatatacctaataattctatgattttatttattcttgcaagtgtt
tttgggatttttatggcatttaatataggcggcaatgatgttgcaaattcctttggaaca
agtgtgggcgctaaaactgttacgataaaacaagctttgatcatcgctgctgtatttgaa
ttaagcggagctatttttgcaggtggttctgtgacaaataccataagaagcggtattgta
gttttaccaaatggtgttgatcctatggtttttgtgtgtattatgctttcagcattatta
agttcagggatttggcttttaatagctagtaaaaaaggattgcctgtatctactactcat
agtattataggtggcatagtgggtgctagtatcgctatgggttttatgttttttaatcaa
catgaagctttttctatggtaaattggaatggaatttataaaattgttgcaagttggatt
atctctcccttgcttggaggacttgttgcgtatttgatttactcatatatttataaacga
attttagagccttcttcgcttattaatgtcaaaattaaagaaattaaaaaagagaaaaaa
gcatttaaagaagaatattttaaaaatttacaaaataaatctcaagaagaacagattaaa
gaattaagcgctatagtgctagatgatgatgagaaaaaaagtgagtataaattaaaaatt
aaacaattaaaagacaaagaaaaagatatagatgtttttagtaagatgaaatttcatgtg
ccattgatagctggtgtggctgctttggtgatttcttctatgtttttgtttaaaggatta
aacaaggtttctactttaaatttgatgcaaaatttatggatagtttttattatttccatt
tttgcttatatagtaactctagcagttgttagattgatgaaaaaaacagaattaaataaa
accatagaaaagattttttcgtggtttcaaatttttactgcttcaagttttgctttttcg
catggggctaatgatattgccaatgctctaggcccatttgctgcaattttagatgtgctt
aaaaataacacaatcaatccaagctcgccagtcccatttgctgtaatgttgatgtttggt
atatctttggttattgggctttggtttttaggcaaagaagttatccaaactgttggatca
aaattagctcaaattaaaccaactacaggttttagtgctgaacttggtgccagtatagtt
atacttttggcaactcaattaggaattcctgttagctcaacacatattttaatcggagcg
atacttggaataggggtgtttaacaaagatgcaaaatggaatatgatgaaacctattggc
cttgcttgggtgattaccttacctgtagcaggaattttatcaagtattatttttatgata
tttgttcaaattttaatcttgtaa

DBGET integrated database retrieval system