KEGG   Chlorella variabilis: CHLNCDRAFT_10756Help
Entry
CHLNCDRAFT_10756  CDS       T02924                                 

Definition
(RefSeq) hypothetical protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cvr  Chlorella variabilis
Pathway
cvr00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:cvr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CHLNCDRAFT_10756
Enzymes [BR:cvr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     CHLNCDRAFT_10756
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 17354272
NCBI-ProteinID: XP_005846927
JGI: ChlNC64A_1_10756
UniProt: E1ZGX0
Position
Unknown
AA seq 261 aa AA seqDB search
ALSPEEWRSFKLALTKGVANPTVLFRFALPDKDHEPGLPVASCLLVRAPIGSEKPDGSRA
FVLRPYTPISRHAKGHMDLAIKVYPGGKMSQHIDHLKVGDQLDFKGPLMKISVEELSKRK
RLGLIAGGSGLTPMLQASWGRRPQPSHHGQDINMLFANVSEADIIAKDRLDGLAKRHKNF
HIHYIVDKTDNKAWGGSVGYITKDLLAKLMPPPADDSLVLVCGPPGLMNAVSGDKLPDKT
QGPLSGLLKDMGYTEQQVFKF
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gcgctctcccccgaggagtggcgcagcttcaagctggcgctgacaaagggtgtggccaac
cccactgtgctgttccgctttgcgctgccagacaaggaccacgagccggggctgccagtc
gcatcctgcctgctggtgcgggcgcccatcggcagcgagaagcccgacggctcccgcgct
ttcgtcctccggccgtacaccccaatctcccggcatgccaaaggacacatggacctggca
atcaaggtctacccgggcggcaagatgagccagcacattgaccatctgaaggtgggggac
cagctggacttcaaggggcccctcatgaagatcagcgtggaggagctgtccaagcgcaag
cggttgggcctgattgcgggcggcagcgggctcacgcccatgctgcaggcaagctggggg
cggcggccacagccaagccatcatggacaggatatcaacatgctgtttgccaatgtgtcg
gaggcagacatcattgccaaggaccggctggatgggctggccaagcggcacaagaacttc
cacatccactacatcgtggacaagacggacaacaaggcgtggggcggcagcgtgggctac
atcaccaaagacctgctggccaagctgatgccgccgcccgccgacgactcgctggtgctg
gtctgcggtccgccgggcctcatgaacgctgtgtccggagacaagctgcccgacaagacc
cagggcccgctgagcggcctcctcaaggatatgggctacacggagcagcaggtgttcaag
ttt

DBGET integrated database retrieval system