KEGG   Chlorella variabilis: CHLNCDRAFT_13547Help
Entry
CHLNCDRAFT_13547  CDS       T02924                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cvr  Chlorella variabilis
Pathway
cvr00052  Galactose metabolism
cvr00500  Starch and sucrose metabolism
cvr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CHLNCDRAFT_13547
   00500 Starch and sucrose metabolism
    CHLNCDRAFT_13547
Enzymes [BR:cvr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     CHLNCDRAFT_13547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N
Motif
Other DBs
NCBI-GeneID: 17354015
NCBI-ProteinID: XP_005846679
JGI: ChlNC64A_1_13547
UniProt: E1ZI55
Position
Unknown
AA seq 139 aa AA seqDB search
KPGFHVAPPQGWMNDPNGPLEFPAGQLYHLFYQYNPSSPKWAAPSWGHVASADLVHWMQL
PSVALQPAAYYDSDGVFSGSATLLTNGTPAIMYTGVSRFEDLGYYYQVQALATPTNTSDP
LLQHWLKRSDPVMPLAPPG
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
aagcccggcttccacgtggcgccgccccagggctggatgaacgacccaaacgggccgctg
gagttcccggcgggccagctgtaccacctcttctaccagtacaacccatcctcgcccaaa
tgggcggcgcccagctggggccacgtcgcatctgccgacctggtgcactggatgcagctg
cccagcgtggccctgcagcccgccgcctactacgacagcgacggcgtgttcagcggatcg
gccacgctgctcacaaacggcacccccgccatcatgtacacaggcgtgtcccgctttgag
gatctgggatactattatcaggtgcaggcgctggccacccccaccaacacctccgaccct
ctcctgcagcactggctcaagcggtcggacccggtcatgccgctggcgccgccaggt

DBGET integrated database retrieval system