KEGG   Chlorella variabilis: CHLNCDRAFT_142930Help
Entry
CHLNCDRAFT_142930 CDS       T02924                                 

Definition
(RefSeq) hypothetical protein
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
cvr  Chlorella variabilis
Brite
KEGG Orthology (KO) [BR:cvr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cvr03041]
    CHLNCDRAFT_142930
   03009 Ribosome biogenesis [BR:cvr03009]
    CHLNCDRAFT_142930
Enzymes [BR:cvr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     CHLNCDRAFT_142930
Spliceosome [BR:cvr03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    CHLNCDRAFT_142930
Ribosome biogenesis [BR:cvr03009]
 Eukaryotic type
  90S particles
   Helicases
    CHLNCDRAFT_142930
  Pre-60S particles
    CHLNCDRAFT_142930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD DUF4217 Helicase_C ResIII
Motif
Other DBs
NCBI-GeneID: 17357286
NCBI-ProteinID: XP_005849550
JGI: ChlNC64A_1_142930
UniProt: E1Z935
Position
Unknown
AA seq 576 aa AA seqDB search
MSGGFAKKLKNKQSRVSVQGPTAAPEHSKEENGQEEQHTQKKRKLQAGAAAVPAAAATAA
VAKAAAGDDGERDNQPSQKKQKGHVGLEVEHQTATVSGIMSSQTFDQLDLAESTKRGIQE
LGFVNMTEVQARTIPQLLVGRDVLGAAKTGSGKTLAFLIPCVELLYRAKFMPRNGTGAVV
ILPTRELALQIYNVARDVMQHHTQTHGLVMGGANRRAEAEKLVKGVNLLVSTPGRLLDHL
QNTKGFVYRNLACLVIDEADRILEIGFEEEMRQIVKILPKDRQTMLFSATQTTKVEDLAR
LSFKRKPLYVGIDDTKAVATREGLEQGYCVVPADKRFLLLFTFLKKNASKKVMVFFSSCN
SVKFHSELLNYIDIPVKAIHGKQKQAKRTTTFFEFCQADSGILLCTDVAARGLDIPAVDW
IIQYDPPDDPKEYIHRELSFLKYLKAAKVPLNEYEFPTSKLSNVQSQLEKLVEKNYYLHQ
SAKEAFRSYILAYNSHHLKDTFNIHSLDLKAVARSFGFSSPPRVNINLESKAAHTRKAQK
AGHGADYRRMKSGHKFSASNPYGKVQEADTRQFVRV
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggcggcttcgcgaaaaagttgaagaataagcagtcccgtgtgtcagtgcaaggg
cccacggcagcaccagaacactccaaggaggagaatggccaagaggagcagcacacgcag
aagaagcgcaagctgcaggcgggagcggcagctgtgcctgccgccgccgccaccgctgca
gtagccaaagcagcagcgggcgatgatggtgagcgggacaaccagccttcgcagaagaag
cagaaggggcacgttgggctggaggtggagcaccaaaccgcgactgtcagcggcatcatg
tcgtctcagacttttgaccagttggacttggcggagtccaccaagcggggcattcaagag
ctgggatttgtaaacatgacagaggtgcaggcacgcaccatcccgcagctgctggtgggc
cgcgacgtgcttggagccgccaaaacagggtcgggcaagacgctcgccttcctcatacca
tgcgtggaactgctttaccgtgccaagttcatgccgcgcaacgggaccggcgctgttgtc
atcctgccaacccgcgagctggcgctgcagatctacaacgtggcgcgcgatgtgatgcag
caccacacgcaaacacatggcttggtgatgggcggtgccaatcgacgtgccgaggccgag
aagctggtcaagggcgtcaacctgctggtctccacacctggccgcctgctggaccacctg
caaaataccaagggctttgtgtaccgcaacctggcctgcctggtgattgatgaggcggat
cgcatcttggagattgggttcgaagaggagatgcggcagattgtcaagatcctgcccaag
gaccgccagaccatgctgttcagcgcgacacaaactacaaaggttgaggacctggcacgg
ttgtcctttaagcgcaaaccactgtacgtcggcatagacgacactaaagccgtggccacc
cgagaggggctggagcagggctactgcgtggtgcctgccgacaagcgtttcctgctgctt
ttcacatttttgaagaagaatgccagcaagaaggtgatggttttcttcagcagctgtaac
agcgtcaaattccatagcgagctcctcaactacattgacattcccgtcaaggccatccac
ggcaagcagaagcaggcgaagcgcaccaccacgttctttgagttttgccaggcagacagt
ggcatcctgttgtgcacggacgtggcggcacgcggcttggacatccccgcagtagactgg
atcatccagtacgatccacctgatgatcccaaagagtacatccaccgtgagctgagtttc
ctcaagtacctcaaggcggccaaggtgcccctgaacgagtacgaattccccaccagcaag
ctgagcaatgtgcagagccagctagagaagttggtggagaagaactactacctgcaccag
agcgcaaaggaagcttttaggtcgtacattctggcctacaactcgcaccacctcaaggac
acattcaacatacactcactggacctcaaggccgtggccagaagttttggcttctcctct
ccgccacgcgtgaacatcaacctagagagcaaggccgcacacacgcgcaaggcgcagaag
gcagggcacggcgccgactaccggcgcatgaagtcgggccacaagttcagcgcttcaaac
ccgtatggcaaggttcaggaagcagacacgcgccaatttgtgcgtgtgtga

DBGET integrated database retrieval system