KEGG   Chlorella variabilis: CHLNCDRAFT_15467Help
Entry
CHLNCDRAFT_15467  CDS       T02924                                 

Definition
(RefSeq) hypothetical protein
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
cvr  Chlorella variabilis
Pathway
cvr00970  Aminoacyl-tRNA biosynthesis
cvr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cvr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CHLNCDRAFT_15467
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cvr03029]
    CHLNCDRAFT_15467
Enzymes [BR:cvr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CHLNCDRAFT_15467
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CHLNCDRAFT_15467
Mitochondrial biogenesis [BR:cvr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CHLNCDRAFT_15467
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-GeneID: 17351479
NCBI-ProteinID: XP_005844256
JGI: ChlNC64A_1_15467
UniProt: E1ZQ03
Position
Unknown
AA seq 92 aa AA seqDB search
VAPPDVRELARMAHISVTDEEVADWGPKLESIVEWFGQLQGVDVEGVPPALRADVEAQST
LRADQVRQPQGGTDLVQQAPDREGPFVRVPKI
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
gttgcaccgcccgatgtgcgggagctggcgcgcatggcacacatttccgtgactgacgaa
gaggtggcggactggggacccaagctagagagcatcgtggagtggtttggtcagctgcag
ggtgtggatgttgagggcgtgccgcccgcgcttcgggctgatgtggaggcgcagagcacg
ctgcgcgccgatcaagtgcggcagcctcagggcgggacagatttggtgcagcaggcaccc
gatcgggaaggcccctttgtgcgagtgccaaaaatt

DBGET integrated database retrieval system