KEGG   Chlorella variabilis: CHLNCDRAFT_19399Help
Entry
CHLNCDRAFT_19399  CDS       T02924                                 

Definition
(RefSeq) hypothetical protein
  KO
K14286  ethanolamine-phosphate phospho-lyase [EC:4.2.3.2]
Organism
cvr  Chlorella variabilis
Pathway
cvr00564  Glycerophospholipid metabolism
cvr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cvr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CHLNCDRAFT_19399
Enzymes [BR:cvr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.2  ethanolamine-phosphate phospho-lyase
     CHLNCDRAFT_19399
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 17358548
NCBI-ProteinID: XP_005851539
JGI: ChlNC64A_1_19399
UniProt: E1Z504
Position
Unknown
AA seq 502 aa AA seqDB search
MVAFNCAAAHRLDAAVCDPVRALEWAPEAAVEFPAAQQQPSAKPQPEQQAGAAKAGILDK
RRRHVGPNLALFFEEDPLHIVRGQGCELFDAEGNSYLDCINNVSHVGHAHPKVAAAVAQQ
LGTLNTNSRYLHEGLATYSEAIAGTMPDPLQASQLAPCSPASNGPLHVAVVDHAYHGHTS
ACIDLSPYKFKGPGGGGRPVHVHVLPCPDVYRGCNLDGGAAARAAIAEAERGGARIAAFF
SESILSCGGQVVLPEGYLAGVYREMRAHGAVCVADEVQCGFGRVGRAFWAFQLQEVVPDI
VTFGKPCGNGFPMAGLVTSPPPGKAFSQRMEFFCNLWEGAPLPAARAGGCTAAPACGLAV
LEVIREEELQANAARMGAHCLRLLRELQEQHPDVIGEVRGEGLMIGVEVVTDPHTQTPAP
ALARHLKHACKAHHRVLLSSEGPFCSVIKVKPPICFSEGQAERMAGALRDALDALTPDDK
AALAAASREEVERIAERHRLLS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggtggccttcaactgcgccgccgctcaccgcctcgacgccgcagtctgcgaccctgtg
cgggcgctggaatgggcccccgaggccgcggtggagttcccagcggcccagcagcagccc
tcagcgaagccccagcccgagcagcaggcaggggccgccaaggcgggcatcctggacaag
cggcggcggcacgtgggccccaacctggccctgttctttgaggaggacccgctgcacatc
gtgcggggccagggctgcgagctgttcgatgccgagggcaacagctacctggactgcatc
aacaatgtgtcccacgtcggccacgcgcaccccaaggtggcggccgcggtggcgcagcag
ctgggcacgctcaacaccaacagccgctacctgcacgaggggctggccacctacagcgag
gcgattgccggcaccatgcccgacccgctgcaggcaagccagctggcgccttgctcacca
gcctccaacggtccgctgcacgtggcggtggtggaccacgcctaccacggccacacctcc
gcctgcatcgacctgtcgccgtacaagttcaaggggccggggggaggcggccgccccgtg
cacgtgcatgtactgccctgccccgacgtgtaccgcgggtgcaacctggatggcggcgcg
gcagcgcgggccgccatcgccgaggcggagcgcggcggcgcccgcatcgcggccttcttc
tcggagtccatcctgagctgcggaggccaggtggtactgcctgaggggtacctggcgggc
gtgtaccgcgagatgcgggcgcacggcgcggtgtgcgtggcggacgaggtgcagtgcggg
tttgggcgcgtggggcgcgccttctgggccttccagctgcaggaggtggtgccggacatc
gtgacctttggcaagccatgcggcaatggcttcccgatggccggcctggtgaccagccca
cccccgggaaaagccttctcccaacggatggagttcttttgcaacctttgggagggcgca
ccgctccctgcggcgcgtgcaggcggctgcaccgcggcgcccgcctgcggcctggcggtg
ctggaagtgatccgtgaggaggagctgcaggccaacgcggcgcgtatgggcgcccactgc
ctgcgcctgctgcgggagctgcaggagcagcaccccgatgtgattggcgaggtgcggggc
gagggcctgatgattggggtggaggttgtgacggacccgcacacccagacgccagcgccc
gcgctggcgcgccacctcaagcacgcctgcaaggcacaccaccgcgtgctgctcagcagc
gaggggcccttctgctcagtcattaaggtcaagccgcccatctgcttcagcgaggggcag
gcggagcgcatggcgggggcgctgcgcgacgcgctggatgcgctcacgcctgacgacaag
gccgcgctggcggcggccagccgggaggaggttgagcgcatcgcagagcgccaccgcctg
ctcagctag

DBGET integrated database retrieval system