KEGG   Chlorella variabilis: CHLNCDRAFT_21535Help
Entry
CHLNCDRAFT_21535  CDS       T02924                                 

Definition
(RefSeq) hypothetical protein
  KO
K16675  palmitoyltransferase ZDHHC9/14/18 [EC:2.3.1.225]
Organism
cvr  Chlorella variabilis
Brite
Enzymes [BR:cvr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     CHLNCDRAFT_21535
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC TRP
Motif
Other DBs
NCBI-GeneID: 17356459
NCBI-ProteinID: XP_005849197
JGI: ChlNC64A_1_21535
UniProt: E1ZAP0
Position
Unknown
AA seq 146 aa AA seqDB search
MQAPTKDHQINGYTVTTKYCTTCSHYRPPRCSHCAVCDNCVDKFDHHCPWVGTCIGRRNY
RFFLLFVSSTALLCCWVFGLSVANLVLAAKEDGWAWGTALGDHPAAIVCAVYTFLGFWFV
GGLTAFHTYLVSTNQTTYEHFRHRYS
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcccccaccaaggaccaccagatcaacgggtacacagtgaccaccaagtattgc
accacatgcagccactaccggccgccgcgctgctctcactgcgccgtgtgcgacaactgt
gtggacaagtttgaccaccactgcccctgggtgggcacctgcatcggccggcgcaactac
cgcttcttcctgctcttcgtctcctccactgccctcctctgctgctgggtgtttggcctg
tcggtggccaacctggtgctggctgccaaggaggacgggtgggcgtggggcaccgcgctg
ggggaccaccccgcggccatcgtgtgcgccgtctacaccttcctgggcttctggtttgtg
gggggcctcaccgccttccacacctacctggtctccaccaaccagaccacctacgagcac
ttccgccaccgctactcg

DBGET integrated database retrieval system