KEGG   Chlorella variabilis: CHLNCDRAFT_25289Help
Entry
CHLNCDRAFT_25289  CDS       T02924                                 

Definition
(RefSeq) hypothetical protein
  KO
K17744  L-galactose dehydrogenase [EC:1.1.1.316]
Organism
cvr  Chlorella variabilis
Pathway
cvr00053  Ascorbate and aldarate metabolism
cvr01100  Metabolic pathways
cvr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    CHLNCDRAFT_25289
Enzymes [BR:cvr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.316  L-galactose 1-dehydrogenase
     CHLNCDRAFT_25289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red LEP503 Rrp40_N
Motif
Other DBs
NCBI-GeneID: 17353379
NCBI-ProteinID: XP_005845958
JGI: ChlNC64A_1_25289
UniProt: E1ZJG3
Position
Unknown
AA seq 327 aa AA seqDB search
MAQAALPKMPRRPLGQTGLEVSVLGFGASPLGGAIDEGEGVAAVKEAFDLGINFFDTSPF
YGDTKSETVLGRGLAQLPRDQIVVATKVGRYGSDTFDFSAQRVAASVRESLARLQLGYVD
LIQCHDIEFTHLDQIVSETLPALQRLREEGLVRHIGITGLPLKIFQFFGGRAPPGAVDTA
LSYCHYTLNDRSLAALLPYLQEKQVGIINASVLSMGLLTHQGPPSWHPAPQPLQQAAAAA
AVAAAAHGVSLPKLALMECVKEPAIASHLVGFCTRHQVRDNVEAVLQGLGLLASPLRQQE
AAALADVRRILEPVQGLTWPSGLPDNN
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggcggccctgcccaagatgcctcgcaggcccctgggccagacggggctggag
gtctcggtgctgggctttggcgcttcgccgctgggaggcgccattgacgagggcgagggc
gtggctgcggtcaaggaggcctttgacctgggcatcaacttcttcgacacctctcccttc
tacggagacaccaaatcggagacggtgctggggcgtgggctggcgcagctgccgcgggac
cagatcgtggtggccaccaaggtgggccgctacggctccgacacttttgacttcagcgcg
cagcgggtggcggccagcgtgcgggagtcgctggcgcggctgcagctggggtacgttgac
ctcatacagtgccacgacatcgagttcacccacctggatcagattgtgagcgagacgctg
ccggcgctacagcggctgcgggaggagggcctggtgcgccacatcggcatcaccggcctg
cccctcaaaatcttccaattctttgggggcagggcgccgccgggggctgtggacacagcg
ctgtcgtactgccactacacgctgaacgaccgcagcctggcggcgctgctgccgtacctg
caggagaagcaagtgggcatcatcaacgctagcgtgcttagcatggggctcttaacccac
cagggaccgccgtcctggcacccggccccgcagccgctccagcaggcggctgctgctgct
gcggtggcggcggccgcccacggcgtcagcttgcccaagctggcgctcatggagtgtgtg
aaggagccggccatcgcctcccacctagtaggcttctgcactcggcatcaggtgcgggac
aatgtggaggcggtgctgcaaggcctgggcctgctggcctcgccgctacggcagcaggag
gcggcggcgctggcagacgtgcggcgcatactggagccggtgcaggggctgacgtggccc
tcgggcctgccagacaataactga

DBGET integrated database retrieval system