KEGG   Chlorella variabilis: CHLNCDRAFT_31569Help
Entry
CHLNCDRAFT_31569  CDS       T02924                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cvr  Chlorella variabilis
Pathway
cvr00450  Selenocompound metabolism
cvr00970  Aminoacyl-tRNA biosynthesis
cvr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cvr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CHLNCDRAFT_31569
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CHLNCDRAFT_31569
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cvr01007]
    CHLNCDRAFT_31569
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cvr03016]
    CHLNCDRAFT_31569
Enzymes [BR:cvr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CHLNCDRAFT_31569
Amino acid related enzymes [BR:cvr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CHLNCDRAFT_31569
Transfer RNA biogenesis [BR:cvr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CHLNCDRAFT_31569
 Prokaryotic type
   Other AARSs
    CHLNCDRAFT_31569
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-GeneID: 17354291
NCBI-ProteinID: XP_005847217
JGI: ChlNC64A_1_31569
UniProt: E1ZHF6
Position
Unknown
AA seq 598 aa AA seqDB search
MATAVHAPSAMWSLRATAAVAGRARLAARQAAFGPCRSRLAHSAPRACAGSDHSNGSGAS
QPFTVTTPLYYVNAAPHMGSAYPTIAADALARFQRLQGRRVTFITGTDEHGEKIALAAAA
RGMAPKEHCDDVVASYKQLWRDLDIGYDSFIRTTDARHEALVVSVLERVWQRGDIYKADY
EGHYCVDCEEYKDEADMDADKNCPVHRKPCVERKEENYFFALSKYQAQLEELCSSPGTCF
VQPESRRNEVLGWVKSGVRDFSISRAAVEWGIPIPRDPKQTVYVWFDALNGYLSGLLPEG
AAADASPEALAAAGWPASLHIIGKDILRFHAVYWPAMLLSAGLPPPDRVYGHGFLTKDGL
KMGKSLGNVLEPRALVGAYGADAVRYYFLREIVFGQDGDFSEERFRNIVNASLANDVGNL
LNRTLNLLRKNCGGEVPLDAADVAADHPLRALAAEKAPAVADAFARLRFDQACEAALSIS
GRGNQYLEETAPWTAFKKGSEEQRAEAAAVLAAVLEAVRVVAVLLSPVTPSLSARIYQQL
GFTPEQHQALTWADTEWGALKQGHATPQPVPVMQRLEGDLVTQPAGAAAAAAAVAAKA
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggccacagcagtgcatgctcccagcgccatgtggtcgctgagggccaccgctgcagtc
gctggacgagctaggctggctgcccggcaggcggccttcggcccctgccgctccaggctc
gcgcattcggccccacgggcctgtgcaggcagcgatcatagcaatggcagtggcgccagc
cagccgttcaccgtgaccacgccgctgtactatgtcaacgccgcgccgcacatgggcagc
gcataccccaccatcgccgccgacgccctggcccgcttccagcgcctgcaaggccgccgc
gtcaccttcatcaccggcaccgacgagcacggcgaaaagattgcgctggcggcggcggcc
cgcggcatggcccccaaggagcactgcgacgacgtcgtggccagctacaagcagctgtgg
cgcgacctggacattggttacgacagcttcatccgcaccaccgacgcgcggcacgaggcg
ctggtggtgtctgtgctggagcgcgtgtggcagcgcggcgacatctacaaggccgactac
gagggccactactgcgtggactgcgaggagtacaaggacgaggccgacatggatgcggac
aagaactgcccggtgcaccgcaagccgtgtgtggagcgcaaggaggagaactacttcttt
gccctctccaagtaccaggcgcagctggaggagctgtgcagcagcccaggcacgtgcttt
gtgcagcccgagtctcgccgcaacgaggtgctggggtgggtgaagagcggggtgcgcgac
ttctccatctcgcgcgccgccgtggagtgggggatccccatcccgcgcgaccccaagcag
accgtgtacgtctggtttgatgccctcaacggctacctgtcaggcctgctgcccgagggc
gccgccgccgacgcctcccccgaggcgctggccgccgccggctggcccgcctcgctgcac
atcatcggcaaggatatcctgcgcttccacgccgtctactggcccgccatgctgctgtcg
gcgggcctgccgccgcccgaccgcgtctacggccatggcttcctcaccaaggacgggctg
aagatggggaagagcctgggcaatgtgctggagccgcgcgcgctggtgggcgcctacggc
gcagacgccgtgcgctactacttcctcagggagattgtgtttggacaggacggcgacttt
agcgaggagcgcttccgcaacatcgtcaacgccagcctggccaacgacgtgggcaacctg
ctgaaccgcacgctcaacctgctgcgcaagaactgcggcggcgaggtgccgctggacgcg
gccgacgtggcggcggaccacccgctgcgcgcgctggcggcggagaaggcgcccgccgtg
gccgacgcctttgcgcgcctgcgcttcgaccaggcctgcgaggcggcgctgagcatcagc
gggcggggcaaccagtacctggaggagacggcgccgtggacggccttcaagaagggcagc
gaggagcagcgggcggaggcggcggcggtgctggcggcagtgctggaggcggtgcgcgtg
gtggcggtgctgctgtcgcccgtcaccccctccctctccgcccgcatctaccagcagctg
ggcttcaccccagagcagcaccaggcgctgacctgggcggacacagagtggggggcgctg
aagcaggggcacgccacgccgcagccagtccccgtcatgcagcggctagagggcgacctg
gtcacgcagcctgctggagcggcagctgcagcagcagccgtggcagccaaggcgtga

DBGET integrated database retrieval system