KEGG   Chlorella variabilis: CHLNCDRAFT_32920Help
Entry
CHLNCDRAFT_32920  CDS       T02924                                 

Definition
(RefSeq) heat shock protein 70
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cvr  Chlorella variabilis
Pathway
cvr03040  Spliceosome
cvr04141  Protein processing in endoplasmic reticulum
cvr04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:cvr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    CHLNCDRAFT_32920
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CHLNCDRAFT_32920
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    CHLNCDRAFT_32920
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cvr01009]
    CHLNCDRAFT_32920
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cvr03041]
    CHLNCDRAFT_32920
   03009 Ribosome biogenesis [BR:cvr03009]
    CHLNCDRAFT_32920
   03110 Chaperones and folding catalysts [BR:cvr03110]
    CHLNCDRAFT_32920
   04131 Membrane trafficking [BR:cvr04131]
    CHLNCDRAFT_32920
   03051 Proteasome [BR:cvr03051]
    CHLNCDRAFT_32920
   03029 Mitochondrial biogenesis [BR:cvr03029]
    CHLNCDRAFT_32920
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cvr04147]
    CHLNCDRAFT_32920
Protein phosphatases and associated proteins [BR:cvr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     CHLNCDRAFT_32920
Spliceosome [BR:cvr03041]
 Complex B
  Other components
   Prp19 complex
    CHLNCDRAFT_32920
 Complex C
   Prp19-CDC5 complex
    CHLNCDRAFT_32920
Ribosome biogenesis [BR:cvr03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    CHLNCDRAFT_32920
Chaperones and folding catalysts [BR:cvr03110]
 Heat shock proteins
  HSP70 / DNAK
   CHLNCDRAFT_32920
Membrane trafficking [BR:cvr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    CHLNCDRAFT_32920
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    CHLNCDRAFT_32920
Proteasome [BR:cvr03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    CHLNCDRAFT_32920
Mitochondrial biogenesis [BR:cvr03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    CHLNCDRAFT_32920
Exosome [BR:cvr04147]
 Exosomal proteins
  Proteins found in most exosomes
   CHLNCDRAFT_32920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DUF1464 Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 17351175
NCBI-ProteinID: XP_005843891
JGI: ChlNC64A_1_32920
UniProt: E1ZQV2
Position
Unknown
AA seq 645 aa AA seqDB search
MSGPAIGIDLGTTYSCVGLWQHDRVEIIPNEQGNRTTPSYVAFTDTERLIGDAAKNQVAM
NPINTVFDAKRLIGRKFSDPTIQHDVSHWPFKVVAGPGDKPMIQVAYKGEEKTFAPEEIS
SMVLVKMKEIAQAYVGADKEVKKAVVTVPAYFNDSQRQATKDAGVIAGLEVMRIINEPTA
AAIAYGLDKKGTTSGEQNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR
LVNFFVQASFKRKHRKDISSNPRALRRLRTSCERAKRTLSSSTQASIEIDSLYEGIDFYS
SITRARFEELNMDLFRKCMEPVEKVLRDAKMDKGQVNEVVLVGGSTRIPKVQQLLQDFFN
GKELCKSINPDEAVAYGAAVQAAILNGETHEKVQDLLLLDVIPLSLGLETAGGVMTVLIA
RNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERSRTKDNNLLGKFELTGIPPAPRGVPQIN
VTFDVDANGILNVSAEDKTTGNKNKITITNDKGRLSKDEIERMVQEAEKYKAEDETHRTR
VEARNGLENAAYGLRNTVRDTNLADKLSAEDKEAIEKAVDKVVDWLDHNQLAEEEEITHQ
REEMEAVCNPIITKLYQGAPPPPEAGGASAGGAASGPGPKIEEVD
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggcccgcaattggcatcgatttgggcaccacctacagctgcgttggcctgtgg
cagcacgaccgcgtggagatcatccccaacgagcagggcaaccgcaccacgccgtcgtat
gtggcattcaccgacaccgaacgccttattggcgacgccgccaagaaccaggttgcgatg
aaccccatcaacacggtgttcgatgccaagcggctcattggacgcaaattctccgacccc
accatccagcacgatgtcagccactggcccttcaaggtggtggctggccctggcgacaag
cccatgattcaggttgcctacaagggggaggagaagacgtttgccccagaggagatcagc
tccatggtgctggttaagatgaaggagattgcgcaggcgtacgtcggcgcggacaaggaa
gtgaagaaggcggttgtgacggtgcccgcctacttcaatgattcgcagcggcaggccacc
aaggacgccggcgtcattgcgggactggaggtgatgcgcatcatcaacgagcccactgct
gccgcaatcgcctacggcctggacaagaagggcaccaccagtggcgaacagaatgtactt
atttttgacctgggcggtggcacctttgatgtgtccctgctgacaattgaggagggcatc
ttcgaggtcaaggcaacagctggcgacacccaccttggcggcgaggactttgacaaccgc
ctggtcaacttctttgtgcaggcaagtttcaagcggaagcaccgcaaggatatcagctcc
aacccccgcgccctccgccgcctgcgcacctcctgcgagcgtgccaagcgcacgctgtcc
tcgtccacccaagcatccattgagattgattctctgtacgagggcattgacttctattcc
tccatcacccgtgcccgcttcgaggagctgaacatggatctcttccgcaagtgcatggag
cctgtggaaaaggtgctgcgcgatgccaagatggacaaggggcaggtgaatgaggtggtt
ttggttggcggctcgacgcgcattcccaaggtgcagcaactgctccaggattttttcaac
ggcaaagagctgtgcaagtctatcaacccagatgaggctgtggcgtacggcgcagctgtt
caggcggccatcctgaatggcgagacgcacgagaaggtgcaggacctgctgctgctggat
gtgatccccctgtccctcggcttggagacggcaggtggtgtgatgacggtcttgattgcg
cggaacacaaccattcccaccaagaaggagcaggtcttctccacctactctgacaatcag
cctggcgtactgatccaggtgtatgagggcgagcgctcccgcaccaaggacaacaacctg
ctgggcaagtttgagctgacgggcatcccgcctgcgccccgcggcgttccacagatcaac
gtcacgtttgatgttgatgcaaacggcatcctgaacgtctctgccgaggacaagaccacc
ggcaacaagaacaagatcaccatcaccaacgacaaggggcgccttagcaaggacgagatt
gagcggatggtgcaggaggccgagaaatacaaggcagaggatgagactcatcgtactcgt
gtcgaggctcgcaacggcttggaaaatgcggcttacgggctccggaacaccgtcagggac
accaacctggccgacaagctgagcgctgaagacaaggaagcgattgagaaggctgtggac
aaggtggtggactggctggaccacaaccagctggccgaggaggaggagatcacccaccag
cgtgaggagatggaggcggtgtgcaaccccatcatcacaaagctctaccagggcgccccc
ccgccgccagaggcaggcggggccagtgccggcggtgcagcatccggcccgggccccaag
atcgaggaggtggactga

DBGET integrated database retrieval system