KEGG   Chlorella variabilis: CHLNCDRAFT_34562Help
Entry
CHLNCDRAFT_34562  CDS       T02924                                 

Definition
(RefSeq) hypothetical protein
  KO
K11717  cysteine desulfurase / selenocysteine lyase [EC:2.8.1.7 4.4.1.16]
Organism
cvr  Chlorella variabilis
Pathway
cvr00450  Selenocompound metabolism
cvr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cvr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CHLNCDRAFT_34562
Enzymes [BR:cvr01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     CHLNCDRAFT_34562
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.16  selenocysteine lyase
     CHLNCDRAFT_34562
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 17357274
NCBI-ProteinID: XP_005849717
JGI: ChlNC64A_1_34562
UniProt: E1Z8I3
Position
Unknown
AA seq 427 aa AA seqDB search
MPAPQVQDAPAAAAAAADLGTATRADFPILHQSVNERPLMYLDNAATSQKPRQVLQTMDE
YYGEGGYNSNVHRGVHALSARATAAYEAAREKIAGFINASSPQEIVYTRNATEAINLVAN
TWGAAQLREGDEVVLSVAEHHSNIVPWQLLAQRRGLVLKFAELTGSEEVDLEKLAALITP
RTRLVSLVHVSNMLGCVLPTQRVAEMAHGVGAKLLLDCCQSVPNMPVDVQTLGADWIVAS
SHKMCGPTGIGFLWARYSLLEQMPPWMGGGEMIQEVRLEGSTYAEPPSRFEAGTPAIAEA
IGLGAACDYLSGLGMERVAAHERELGAHLYWQLRSIDRVRIYGPSPEARLGRAALATFNV
EGIHPTDISTILDSTGVAVRSGHLCTQPVHRHLGISSSVRASPYIYNTKAEVDAFVDALK
DAIQFFT
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgccgcaggtgcaggacgccccagcggcggccgctgccgccgcggacttgggc
accgctacccgcgccgacttccccattctgcaccagagtgtgaacgagcggccgctgatg
tacctggacaatgcagccacgtcgcagaagccgcggcaggtcctgcagacgatggacgag
tactatggcgagggcggatacaacagcaacgtgcaccgcggggtgcacgccctgagcgca
cgtgccactgccgcctacgaggccgcccgcgagaagattgcgggcttcatcaacgcctcc
tcgcctcaggagatcgtctacacacgtaatgccacggaggccatcaacctggtggccaac
acgtggggcgcggcacagctgcgcgagggcgacgaggtggtgctgagcgtggcggagcac
cactccaacatcgtgccctggcagctgctggcgcagcgcaggggactggtgctcaagttt
gcggagctgaccggcagcgaggaggtggacctggagaaactggcggccctcatcacgccc
cgcacccgcctcgtctcgcttgtccacgtgtccaacatgctgggctgcgtgctgcccacg
cagcgcgtggcagagatggcccacggcgtgggcgcaaagctgctgctcgactgctgccaa
tctgtgcccaacatgccggtggatgtgcagacgcttggcgccgactggattgtggcctct
agccacaagatgtgcggccctacaggcatcggcttcctgtgggcccgctactcgctgctg
gagcagatgccgccgtggatgggtggtggcgagatgattcaggaggtgcggctggagggc
agcacatatgcggagccgccctcgaggttcgaggcgggcacccccgccattgctgaggcc
atcgggcttggtgccgcctgcgactacctgtcggggctcggcatggagcgtgtggcggcg
catgagcgcgagctgggcgctcacctgtattggcagctgcggtcgattgatcgtgtgcgc
atctatggtcccagcccggaagcgcggctgggccgtgccgctctggccaccttcaatgtt
gagggcatccaccccacagacatatccaccatcctggacagcacgggcgtggcggtgcgg
tcgggccacctgtgcacgcagccggtgcaccgtcacctgggcatctccagctcggtgcgt
gcatcaccatacatttacaacaccaaggcggaggtggatgcgtttgtggatgccctcaag
gacgccattcagtttttcacttga

DBGET integrated database retrieval system