KEGG   Chlorella variabilis: CHLNCDRAFT_35936Help
Entry
CHLNCDRAFT_35936  CDS       T02924                                 

Definition
(RefSeq) hypothetical protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
cvr  Chlorella variabilis
Pathway
cvr03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cvr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    CHLNCDRAFT_35936
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cvr03041]
    CHLNCDRAFT_35936
Enzymes [BR:cvr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     CHLNCDRAFT_35936
Spliceosome [BR:cvr03041]
 Complex C
  Other components
   Step II factors
    CHLNCDRAFT_35936
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C DEAD AAA_22 AAA_19 AAA_30 DUF2075 AAA_24 PhoH T2SSE AAA_16
Motif
Other DBs
NCBI-GeneID: 17354094
NCBI-ProteinID: XP_005846636
JGI: ChlNC64A_1_35936
UniProt: E1ZHW8
Position
Unknown
AA seq 692 aa AA seqDB search
MFLPSGSGQQALHPLKPAPWADLKVGGPRRLLLLCSQRLDKERQQLPVWSARERLVELVR
DNQVLVVIGETGSGKTTQIPRFLYDAGLAKGGAVACTQPRRVAAVTVAQRVADEMGTDLG
AKVGYSIRFDDRTSGATRIKYLTDGMLLREALVDPLLQRYKVVVLDEAHERTVATDVLFG
LLKAVCRQRPADFRLVVMSATLDAAAFTRYFEGAQAAYVEGRQFPVQVMYTAVSEDSYQD
AAITAALQVHCEEGPGDILVFLTGQDEIESCERLISEAAAALPPDPDRPQLAVLPMYAAL
PPEAQLRVFQPAPPNTRKVILSTNIAETSITISGVRYVIDTGFVKSRSYSPRLGADCLQV
TPVSQAQARQRSGRAGREAPGKAFRLYTEASFQQLPPTTLPEIQRTNLASVPHLPAPACP
LQLKALGVADVVGFDFMDPPPRAALLRSLELLLALGALDARGDLTQPVGAQLARLPVEPM
YGKVLLASGEMGCSVEAVAVVAMVSTDVVFHLPRGKREEAVEAHQQFRCREGDHLTLLAV
FRAYSDVSRKGHERSHWCRAHFVNPRAMRKAMDIHSQLKEHLQALGIPLVSCGEDTRVLR
RALVAGLFPHAARRQLDGSYKVIASGQAVAIHPSSVLRAQNAKPECIVFNELVRTTRQYA
RDAVVVEPSWLPELAPAYFARQHANQQHNGGA
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgccctcagggagtggccagcaggctctgcaccctctcaaaccagccccatgg
gccgatctgaaagttggcggaccgcgccgcctgctgctgctgtgcagccagcgcctggac
aaggagcggcagcagctgccggtttggtcggctcgggagcggctggtggagctggtccgc
gacaaccaggtgctggtcgtgattggagagacagggtccggcaagaccacccagatccct
cgcttcctgtacgatgccggcctcgccaagggcggagcagtcgcctgcacccagccgcgc
cgcgtggcggcggtgacagtggcgcagcgggtggccgatgagatgggcactgacctgggg
gccaaggtcggctactccatccgctttgacgaccgcaccagcggcgccacgcgcatcaag
tacctcacagacggcatgctgctgcgggaggcgctggtggacccgctgctgcagcgctac
aaggtggtggtgctggacgaggcgcacgagcgcacggtggccaccgacgtgctgtttggg
ctgctcaaggcggtgtgccggcagcgcccggccgacttccgccttgtggtcatgagcgcc
acgctggacgccgccgccttcacgcgctactttgagggcgcgcaggccgcctacgtggag
ggccgccagttccctgtgcaggtgatgtacacggcggtatcggaggacagctaccaggat
gccgccatcacggcggcgctgcaggtgcactgcgaggagggccccggcgacatcctggtg
ttcctgacgggccaggacgagatcgagtcgtgcgagcggctgatcagcgaggcggcggcg
gcgctgccgcccgaccccgaccgcccgcagctggcggtgctgcccatgtatgcggcgctg
ccgccggaggcgcagctgagggtgttccagcctgcgccgcccaacacgcgcaaggtcatc
ctgtccaccaacatcgccgagacctccatcaccatctcaggcgtgcgctacgtcatcgac
accggctttgtcaagtcgcgcagctacagcccgcgcctgggagcagactgcctgcaggtg
acccctgtgtcgcaggcgcaggcgcggcagcgcagcgggcgcgcgggccgggaggccccc
ggcaaggccttccgcctctacaccgaggcctccttccagcagctgccccccaccacgctg
cccgagatccagcgcaccaacctggcgtccgtgccacacctgcctgcccctgcctgcccc
ctgcagctcaaggcgctgggcgtggccgacgtggtgggctttgacttcatggacccgcca
ccccgcgccgccctgctgcgctcgctggagctgctgctggcgctgggggcgctggacgcg
cggggggacctcacgcagcccgtgggcgcccagctggcgcggctgccggtggagcccatg
tacggcaaggtgctgctggccagcggggagatggggtgcagcgtggaggcggtggccgtg
gtggccatggtgtccacagacgtcgtcttccacctgcccaggggcaagagggaggaggcg
gtggaggcgcatcagcagttccggtgccgcgagggcgaccacctcaccctgctggccgtg
ttccgggcgtacagcgacgtgagcaggaaggggcacgagcggtcgcactggtgccgcgcc
cactttgtcaacccgcgggccatgcgcaaagcgatggacatacactcgcagctcaaggag
cacctgcaggcgcttggcatcccgctggtttcgtgcggcgaggacacgcgggtgctgcgg
cgcgccctggtggcgggcctcttcccgcatgccgccaggcggcagctggacgggagctac
aaggtgattgccagcgggcaggcggtggccatccacccctcctccgtgctgcgcgcccag
aacgccaagcccgagtgcatcgtgttcaacgagctggtgcgcaccaccaggcagtacgcg
cgggacgcagtggtggtggagcccagctggctgcccgagctggcgccggcctactttgcc
aggcagcacgccaaccagcagcacaatggcggcgcctag

DBGET integrated database retrieval system