KEGG   Chlorella variabilis: CHLNCDRAFT_37582Help
Entry
CHLNCDRAFT_37582  CDS       T02924                                 

Definition
(RefSeq) hypothetical protein
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
cvr  Chlorella variabilis
Brite
KEGG Orthology (KO) [BR:cvr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cvr01001]
    CHLNCDRAFT_37582
Enzymes [BR:cvr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     CHLNCDRAFT_37582
Protein kinases [BR:cvr01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   CHLNCDRAFT_37582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo APH Haspin_kinase RIO1 Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 17350447
NCBI-ProteinID: XP_005843147
JGI: ChlNC64A_1_37582
UniProt: E1ZT36
Position
Unknown
AA seq 297 aa AA seqDB search
MAADLGPFPEGGKKLRKDARLEDVYSLGSIIGTGGFSEVQVATDRAIRHQCACKSMPLPP
ADSESKAERQARMAALREISSMLGLEHPNVVGLREYFVESNRVYLIMELLRGGELLDAVN
THGPFSEEDARTIFLQLMRGVQYLHSVGVVHRDLKLDNLLLAKKGDISCLKIADFGVAMK
GSPAVLNSMRTVCGSPQYIAPEVICAGKKRDAASTDADLDGYGPACDLWSCGVILFMLLG
GYPPFWHESKPQLLEAVERGEFEFADPVWQEVSWQAKDLVSKLLVVDPDKRLTPAQA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgacctagggccattcccagagggcggcaagaagctgcgcaaggacgcccgg
ctggaggatgtgtacagcctgggcagcatcatcggcactggaggcttctcagaggtgcag
gtggccacggaccgggctattcggcatcagtgcgcctgcaagtcaatgccgctgccgccg
gcagacagcgagtccaaggcggagcggcaggccaggatggcggcgctgcgtgaaatcagc
tcgatgttgggcctagagcatcccaacgttgtgggcctgcgagagtactttgtcgaaagc
aacagggtgtacctgatcatggagctgctgcgaggcggcgagctgctggacgcggtgaac
acgcacgggccgtttagcgaggaggatgcgcgcaccatattcctgcagctcatgcgtggc
gtccaatacctgcactctgtgggggtggtgcaccgcgacctgaagctggacaatctgctg
ctggcaaagaagggtgacatcagttgtttgaagattgcagactttggggttgccatgaaa
ggctcccccgcagtgctcaacagcatgaggaccgtgtgtggctcgccgcagtatattgcg
ccagaggtgatctgcgccggcaagaagcgcgacgctgccagcacagatgcagatctggat
gggtacggcccagcctgcgacctgtggagctgcggcgtcatcctgttcatgctgctgggc
ggctacccgcccttctggcacgagagcaaaccgcagctactggaagctgttgagcgcggc
gagtttgaatttgccgaccctgtgtggcaggaggtcagctggcaggccaaggacctggtc
tccaagctgctggtggtggacccagacaagcggctgacccctgcgcaggca

DBGET integrated database retrieval system