KEGG   Chlorella variabilis: CHLNCDRAFT_52583Help
Entry
CHLNCDRAFT_52583  CDS       T02924                                 

Gene name
PDC2
Definition
(RefSeq) hypothetical protein
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
cvr  Chlorella variabilis
Pathway
cvr00010  Glycolysis / Gluconeogenesis
cvr01100  Metabolic pathways
cvr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHLNCDRAFT_52583 (PDC2)
Enzymes [BR:cvr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     CHLNCDRAFT_52583 (PDC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C Acyl-CoA_ox_N
Motif
Other DBs
NCBI-GeneID: 17354666
NCBI-ProteinID: XP_005847311
JGI: ChlNC64A_1_52583
UniProt: E1ZFZ7
Position
Unknown
AA seq 601 aa AA seqDB search
MASTAGPAAAAVEPRSLGQHLASRLVQIGCSRFFGVPGDYNLTLLDELEKEPGLKGAWCC
NELNAGKQLWCVTGRHRISPNSYAADGYGRLKGVGCAVVTFTVGGLSIINAIAGAFAESL
PVICITGGPNTNDFASNRLIHHTLGRKFDFMQELEAFKQVTCEQVVIHSLDDAHEEIDKA
ISAALLHSKPAYICVCCNLAGKRQRRRRRRQQRRMHHPSFDTSPIPYSLSTKQSNKRSLE
AAVEAAAAFLESKQKPVALAGPQLRIGGASQQFMKCVEASGYPYANMAAAKSLVPESHRQ
YMGTYWGQISAPCVSEVVESADAYLVAGPVFSDYASVGYTLGLSESKMVRVDPYRVTIAG
GKGGQVFGCVNMRDFLAALAARRLKPNATSMDIYRRLYAPPPEVAPSPAGSPLQTKVLFK
HIQGLLQPSTMLLGETGDAIFNCQKLALPDGCRYDWSQQYGSIGWSVGATLGLAMAGRDA
GRREVSTMLRYNLNPIIFLINNGGYTIEVEIHDGPYNVIKNWDYVGLVQAMQNGQGQLFA
TRVRTEAELADAVKVVRREAKDRLCFIECIIHRRATDDCSKELLEWGARVAAANSRPPKP
S
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggcctctaccgccggccctgccgcggcggcggtggagccccgcagcctgggccagcac
ctggcctcacggctggtgcagattggctgcagccggttctttggggtgccgggcgactac
aacctgaccttgctggatgagctggagaaggagccaggcctgaagggtgcctggtgctgc
aacgagctgaatgcaggcaagcaattgtggtgtgtcacgggacgtcacaggatttcacca
aacagctatgcagcggatgggtatggtcgcctgaagggcgtaggatgcgctgtcgtgacc
ttcactgtcggtggcctgtcaatcatcaacgcaatcgcaggggcctttgcggagagcctg
ccggtcatctgtatcactggcggacccaacactaacgacttcgcctccaacaggctcatc
caccacaccctgggccgcaagtttgacttcatgcaagagctcgaagccttcaagcaagtg
acgtgcgagcaggtggtcatccacagcctggatgatgcgcacgaggagattgacaaggcc
atctcagccgcgctcctgcactccaagcccgcctacatctgcgtctgctgcaacctggcc
ggcaagcggcagcggcggcggcggcggcggcagcagcggcgcatgcaccatccctcgttt
gacacgagccccatcccctactcactttccaccaagcagtcgaacaagcgcagcctagag
gccgcggtggaggcagcggcagcattcctggagagcaagcagaagccggttgctttggcc
ggccctcagctgcgcataggcggcgccagccagcagttcatgaagtgtgtggaggcgagc
ggctacccttatgccaacatggcagctgccaagagcctggtgcccgagagccacaggcag
tacatgggaacctactggggccagatctcggcgccctgcgtctccgaggtggttgagtcg
gcggatgcctacctcgtcgccggccccgtcttctctgactatgcctctgttggatatacc
ctgggcctgtcagagtccaagatggtgcgtgtggacccctaccgagtcaccatcgccggc
ggcaagggcggccaggtgtttggctgcgtgaacatgcgggacttcctggccgccctggcc
gcccgccgcctcaagcccaacgccaccagcatggacatctaccgccgcctgtatgcgccg
ccgccggaggtggcaccctcccccgcgggctccccgctgcagaccaaggtgctgttcaag
cacatccagggcctgctgcagcccagcaccatgctgctgggcgagactggcgacgccatc
ttcaactgccagaagctcgccctgcccgacggctgccgctacgactggtcccagcagtat
ggcagcatcgggtggagcgtgggcgccacgctggggctggcgatggccggcagggacgcg
gggcgccgcgaggtgtccaccatgctgcggtacaacctcaaccccatcatctttctcatc
aacaacggcgggtacacaattgaggtggagatccatgatggcccctacaacgtcatcaag
aactgggactacgtgggcctggtgcaggccatgcagaatgggcagggccagctgttcgcc
acgcgggtgcgcacagaggcagagctggctgatgcggtcaaggtcgttcggcgggaggcc
aaggaccggctgtgcttcatcgagtgcatcatccacaggcgcgccacagatgactgctct
aaggagctgctggagtggggcgctcgcgtggcggcggccaacagccgcccccccaagccg
tcctga

DBGET integrated database retrieval system