KEGG   Chlorella variabilis: CHLNCDRAFT_57492Help
Entry
CHLNCDRAFT_57492  CDS       T02924                                 

Definition
(RefSeq) hypothetical protein
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
cvr  Chlorella variabilis
Pathway
cvr00860  Porphyrin and chlorophyll metabolism
cvr01100  Metabolic pathways
cvr01110  Biosynthesis of secondary metabolites
Module
cvr_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:cvr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CHLNCDRAFT_57492
Enzymes [BR:cvr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CHLNCDRAFT_57492
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     CHLNCDRAFT_57492
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Thi4 FAD_oxidored FAD_binding_2 Pyr_redox_2 FAD_binding_3 Lycopene_cycl NAD_binding_9 Pyr_redox HI0933_like Trp_halogenase
Motif
Other DBs
NCBI-GeneID: 17356178
NCBI-ProteinID: XP_005848664
JGI: ChlNC64A_1_57492
UniProt: E1ZC76
Position
Unknown
AA seq 338 aa AA seqDB search
MASTATLHGAPCCSARPVGRRHIAAPSIQHNGPRLAARVQQRKGAGERRSALRVQAVQAP
PEKAGASTGSAADDSGVYDVVVVGAGISGLTTAQALTTQHSGVARRVLVTEGRDRVGGNI
TSVSNKEEGLLWEEGPNSFQPNDSILQAAVDAGVADQLVLGDPTAPRFVYWDKKLRPTPS
GPDALTFDLMSIVGKIRAGLGALGFKAPMPDYEESVEQYVRRNLGAEVFERLIEPFCSGV
YAGDPKKLSMKAAFGKVYDLEKKGGSIVGGVIKLIQERRANPPPPRSPALPPKPAGQTVG
SFRSGLRTLPDAMAARLGDAVRTSWQLKELSKEGEAYK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggcctccacagcaacactgcacggcgcgccctgctgctcggcgcggcccgtgggccgc
cggcatattgcagcaccgagcatccagcacaatgggccgcgcctggcggccagggtgcag
cagcggaagggggcaggggagcggcgctcggcactgcgtgtgcaggccgtccaggcccct
cccgagaaggcgggggcgagcacagggagcgcagcagacgacagcggcgtttacgacgtt
gtggtcgtgggcgccggcatctccggcctcaccaccgcccaggcgctgaccacgcagcac
agcggcgtggcgcggcgggtgctggtgaccgagggccgcgaccgcgtgggcggcaacatc
acctccgtgtccaacaaggaggaggggctgctgtgggaggaggggcccaactccttccag
ccaaacgactccatcctgcaggccgcggtggacgccggcgtggcggaccagctggtactg
ggcgaccccacggcgccgcgttttgtgtactgggacaagaagctgcgccccacgccctcc
ggccccgacgcgctcacgttcgacctgatgagcatcgtgggcaagatccgggcggggctg
ggcgcgctgggcttcaaggcgcccatgccagactatgaggagagcgtggagcagtatgtg
cggcgcaacctgggggccgaggtgtttgagcgcctgatcgagcccttctgcagcggcgtg
tacgccggcgaccccaagaagctgtccatgaaggcggcctttggcaaggtgtacgacctg
gagaagaagggcggcagcatcgtgggcggcgtgatcaagctgattcaggagcggcgcgcc
aacccgccgccgccgcgcagcccagcgctgccgcccaagcccgcgggccagacggtgggc
tccttccgctccggcctgcgcacgctgccggatgccatggcggcgcggctgggagacgcg
gtgcgcaccagctggcagctcaaggagctcagcaaggaaggggaggcctacaagtga

DBGET integrated database retrieval system